KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF10510Help
Entry
HIBPF10510        CDS       T01395                                 

Definition
protein disulfide isomerase ii
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Brite
Enzymes [BR:hif01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HIBPF10510
Secretion system [BR:hif02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HIBPF10510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(998261..998950)
Genome map
AA seq 229 aa AA seqDB search
MKKIFTALLCVAAANAMADNAAIKRKLQSFNISNIAIKSSPISGIKTAVTDQGILYVSED
GKYLFEGKLYELTNNGPVDVAGKILVDKLNSYKDEMIVYPAKNEKHVVTVFMDITCHYCH
LLHQQLKEYNDLGITVRYLAFPRAGMNNQTAKQMEAIWTAKDPVFALNEAEKGNLPKEVK
TPNIVKKHYELGIQFGVRGTPSIVTSTGELIGGYLKPADLLRALEETAQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatttttaccgcacttttgtgcgtggctgcggctaatgcaatggcagataat
gcggcaattaaacgcaaattacagtcttttaatatatcaaatattgctattaaatcttcg
ccgatttcaggcattaaaacggctgttacggatcaaggtatactctatgtgagcgaagat
ggaaaatatctttttgaaggtaaactttatgaactcacaaataatggtcctgttgatgtc
gcaggtaaaattttagtagataaacttaattcttataaagacgagatgattgtttatcct
gcgaaaaatgaaaaacacgtagtaacagtatttatggatattacttgccattattgccat
ttattacatcagcaattaaaagaatataacgatcttggcattaccgtgcgttatttagct
ttccctcgtgcaggtatgaataatcaaacggcgaaacaaatggaagcgatttggacggcg
aaagatcccgtttttgctttaaatgaagcagaaaaaggcaatttaccaaaagaagttaaa
acgccaaatatcgtgaaaaaacattatgaattaggtattcaatttggtgtacgaggaaca
ccaagtattgttacctcaactggtgagcttattggcggttatttaaaaccagctgattta
ttaagagctcttgaagaaacggcacaataa

DBGET integrated database retrieval system