KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF11860Help
Entry
HIBPF11860        CDS       T01395                                 

Definition
udp-n-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hif00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:hif00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1127109..1128383
Genome map
AA seq 424 aa AA seqDB search
MDKFRVYGQSRLSGSVNISGAKNAALPILFAAILATEPVKLTNVPELKDIETTLNILRQL
GVIANRDETGAVLLDTSNINHFTAPYELVKTMRASIWALAPLVARFHQAQVSLPGGCSIG
ARPVDLHISGLEKLGADIVLEEGYVKAQVSDRLVGTRIVIEKVSVGATLSIMMAATLAKG
TTVIENAAREPEIVDTADFLNKMGAKITGAGSDHITIEGVEHLTGCEHSIVPDRIETGTF
LIAAAISGGRVVCQNTKADTLDAVIDKLREAGAQVDVTENSITLDMLGNRPKAVNIRTAP
HPGFPTDMQAQFTLLNMVAEGTSIITETIFENRFMHIPELIRMGGKAEIEGNTAVCHGVE
QLSGTEVIATDLRASISLVLAGCIATGETIVDRIYHIDRGYEHIEDKLRALGAKIERFSG
SDEA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttcgtgtttatgggcaatctcgtttaagtggaagtgtgaatatttcaggc
gcaaaaaacgccgcacttccaattctttttgcggctattttagctacagaacctgttaaa
ttgacaaatgttcccgaacttaaagatattgaaacaactttaaatattttgcgtcaatta
ggcgtgattgcaaatcgtgatgaaactggtgcagttttattagatacctctaatatcaat
catttcactgcaccttatgaattggttaaaactatgcgtgcttcaatttgggcattggca
cctttagtcgctcgtttccatcaagctcaagtctcattacctggaggttgttctatcgga
gctagacctgttgatctccacattagcggtttagaaaaattaggtgcggacatcgttctt
gaagaaggatatgtaaaagcacaagtatcagatcgtcttgttggaactcgaattgtaata
gaaaaagtaagtgtaggcgcaactttatctattatgatggcagcaacccttgcgaaaggt
acgactgttattgaaaacgccgctcgtgaacctgaaattgtagatactgcagatttcctt
aataaaatgggtgcgaaaataacaggtgcaggttctgatcacattacgattgaaggtgtt
gaacatttaactggttgtgagcacagtattgtgccagatcgtattgaaacgggaacattc
ttaattgctgcagccatttcgggcggtcgtgttgtttgtcaaaatactaaagcggatact
ttagatgccgtaattgataaactccgtgaagctggtgcgcaagttgatgtaactgaaaat
agcattactttagatatgcttggtaatcgccctaaagcagtgaatattcgtactgcacca
catccagggttcccaactgatatgcaggctcaatttactttattaaatatggtggcagaa
ggtacaagcattatcactgaaacgatttttgaaaatcgttttatgcatattcctgaatta
attcgtatgggtggtaaagctgaaattgaagggaatacagcggtatgtcacggggttgaa
caattgtctggcacagaggtaatagcgacagatttacgcgcttcaatcagtttagtgctt
gcaggttgtatcgcaacgggtgaaaccattgtagatcgtatttatcatatcgatcgtggt
tatgaacatatcgaagataaattacgtgctctaggtgcgaaaattgaacgtttttctgga
agtgatgaagcgtaa

DBGET integrated database retrieval system