KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF11860Help
Entry
HIBPF11860        CDS       T01395                                 

Definition
udp-n-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hif00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HIBPF11860
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HIBPF11860
Enzymes [BR:hif01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     HIBPF11860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1127109..1128383
Genome map
AA seq 424 aa AA seqDB search
MDKFRVYGQSRLSGSVNISGAKNAALPILFAAILATEPVKLTNVPELKDIETTLNILRQL
GVIANRDETGAVLLDTSNINHFTAPYELVKTMRASIWALAPLVARFHQAQVSLPGGCSIG
ARPVDLHISGLEKLGADIVLEEGYVKAQVSDRLVGTRIVIEKVSVGATLSIMMAATLAKG
TTVIENAAREPEIVDTADFLNKMGAKITGAGSDHITIEGVEHLTGCEHSIVPDRIETGTF
LIAAAISGGRVVCQNTKADTLDAVIDKLREAGAQVDVTENSITLDMLGNRPKAVNIRTAP
HPGFPTDMQAQFTLLNMVAEGTSIITETIFENRFMHIPELIRMGGKAEIEGNTAVCHGVE
QLSGTEVIATDLRASISLVLAGCIATGETIVDRIYHIDRGYEHIEDKLRALGAKIERFSG
SDEA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttcgtgtttatgggcaatctcgtttaagtggaagtgtgaatatttcaggc
gcaaaaaacgccgcacttccaattctttttgcggctattttagctacagaacctgttaaa
ttgacaaatgttcccgaacttaaagatattgaaacaactttaaatattttgcgtcaatta
ggcgtgattgcaaatcgtgatgaaactggtgcagttttattagatacctctaatatcaat
catttcactgcaccttatgaattggttaaaactatgcgtgcttcaatttgggcattggca
cctttagtcgctcgtttccatcaagctcaagtctcattacctggaggttgttctatcgga
gctagacctgttgatctccacattagcggtttagaaaaattaggtgcggacatcgttctt
gaagaaggatatgtaaaagcacaagtatcagatcgtcttgttggaactcgaattgtaata
gaaaaagtaagtgtaggcgcaactttatctattatgatggcagcaacccttgcgaaaggt
acgactgttattgaaaacgccgctcgtgaacctgaaattgtagatactgcagatttcctt
aataaaatgggtgcgaaaataacaggtgcaggttctgatcacattacgattgaaggtgtt
gaacatttaactggttgtgagcacagtattgtgccagatcgtattgaaacgggaacattc
ttaattgctgcagccatttcgggcggtcgtgttgtttgtcaaaatactaaagcggatact
ttagatgccgtaattgataaactccgtgaagctggtgcgcaagttgatgtaactgaaaat
agcattactttagatatgcttggtaatcgccctaaagcagtgaatattcgtactgcacca
catccagggttcccaactgatatgcaggctcaatttactttattaaatatggtggcagaa
ggtacaagcattatcactgaaacgatttttgaaaatcgttttatgcatattcctgaatta
attcgtatgggtggtaaagctgaaattgaagggaatacagcggtatgtcacggggttgaa
caattgtctggcacagaggtaatagcgacagatttacgcgcttcaatcagtttagtgctt
gcaggttgtatcgcaacgggtgaaaccattgtagatcgtatttatcatatcgatcgtggt
tatgaacatatcgaagataaattacgtgctctaggtgcgaaaattgaacgtttttctgga
agtgatgaagcgtaa

DBGET integrated database retrieval system