KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF12081Help
Entry
HIBPF12081        CDS       T01395                                 

Definition
type iii restriction-modification system enzyme
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1154271..1157045
Genome map
AA seq 924 aa AA seqDB search
MANDKTLFEVIENRKAVYLEDGDDEKYRLPEFVSNNLKYPFFEWQKSALENFVIFDRTSK
LKDFPDIKNRPTHLLFNMATGAGKTMMMAALILYYFEKGYRHFLFFVNQNNIVDKTENNF
IDPTHAKFLFQPKILQGDKVIPIRKVETFSLHSDGIEIKFTSIQKLYNDIHTERENQTTL
ADLHKLNLVMLGDEAHHLNAQTKGKKQGELELEKEMNDRTSHAEIERKGWEHMVLELLLN
KNGNPSQNVLLEFTATLPENADVQQKYADKIITKFGLKEFLQKGYTKEINLVSSTLGKKE
RVLHALLFAWYRHQIALKYGIANFKPVMLFRSKTIDESKADYLAFLNWVENVQADDFSFL
TTFSTSLNDSDNANEQGKTRTEQALKFMQENGFEFVHLANWVKQNYQKHNVIITNSESNK
TKKEKTDSETEKLLNNLEAADNPIRAIFTVDRLTEGWDVLNLFDIVRLYEGQNGGGSNKK
SGKTAAATVSEKQLIGRGVRYFPFSFEDKQPNKRKFDNDMQHELRILEELFYYTHDEQSR
YITELKNELRKDGYLPEKDDDKVLTTFKMKSEFADNKDFRELLIWANKKIPNPNAKANNA
DSLKANPQTFLFQVHCNQLLQETQFKADANDEIALQLGTQNNFPRTIKMSEMERHIFNKA
LHIKGKNSQSLFHFDRLQSKLNIQNRNELQNNLLKDWKIEFLGLGQDKQISPDDKLAGCL
RILEMVEKRLNESDKPFIGTKEFTPKKLWEIFGTPKQKWVKKDDVKTAIATQNDWYVMDN
FAGTSLEEALIQFISERLGDLKSQYDVHLIRNEEVFKLNNFTNGEGFMPDFILLLKDKQK
SSSNGVDGFLHYQIFIEPKGGHLVENDLWKNAFLEAITVEYGKNKILQKDTPHYRLIGLP
FFTDNQENGEFTESFPLGEASLEK
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatgataaaacgttgtttgaagtaattgaaaaccgcaaagctgtgtatttggaa
gacggagatgatgaaaaatacaggctgcctgaatttgtttcaaataatttgaaatatccg
ttttttgaatggcaaaaatcggctttagaaaactttgtgatttttgaccgcacttcaaaa
ttaaaggattttcccgatatcaaaaaccgccctacccatttgctatttaatatggcaaca
ggtgcaggcaaaacgatgatgatggcggcattgattttgtattattttgaaaaagggtat
cggcattttctgttttttgtgaatcaaaacaatatcgtggataaaacggaaaataatttt
attgacccaacgcacgcgaaatttttatttcagccaaaaattttgcagggcgataaggtt
attcctattcgcaaagtggaaacgtttagcctacattcagacggcattgaaattaaattt
accagcattcaaaaactgtataacgatattcacaccgagcgagaaaaccaaaccacattg
gcggatttgcacaaattgaatcttgtgatgctgggcgatgaagcacatcatttaaacgcg
caaaccaaaggcaaaaaacaaggcgaattagagttagaaaaggaaatgaacgaccgcacc
agccatgccgaaattgaacgtaaaggctgggagcatatggttttggaattgttactcaat
aaaaatggcaatcctagccaaaatgtgctgttggaatttaccgccacactgcctgaaaac
gctgacgtgcaacaaaaatacgctgataaaatcatcacaaaatttggcttaaaagaattt
ttacaaaaaggttataccaaagaaatcaatttggtatccagtacgctgggtaagaaagaa
cgagtgttgcacgctttattgtttgcttggtatcgccatcaaatcgcattgaaatatggc
attgccaatttcaagcctgtgatgttatttagaagtaagacgattgatgaatcaaaagcg
gattatttggcatttttaaattgggtagaaaatgtgcaagcggatgatttttcgttttta
acgacattttcaacaagcttaaacgatagcgataacgccaacgaacaaggcaaaacccgc
accgaacaagccctaaaatttatgcaggaaaatggctttgagtttgtgcatttggcaaat
tgggtaaaacaaaattatcaaaaacataatgtgattattaccaactccgagagcaacaaa
accaaaaaagaaaaaaccgacagcgaaacggaaaaattgctaaataatttggaagcggct
gataatccgatccgcgctatttttacggtggacagattaaccgaaggttgggacgttctg
aatttgtttgatattgtgcgtttatatgaagggcaaaacggcggcggttcaaataaaaaa
tcgggcaaaacggctgccgccaccgtatcagaaaagcagttaattggtcgtggcgtgcgt
tattttccattttcgtttgaagataaacagccgaataaacgcaaatttgacaacgatatg
caacacgaattgcgtattttggaagaattgttttattacacgcacgatgagcaatcccgc
tatattacagaactaaaaaacgagttgcgaaaagacggttatttgcctgaaaaagacgat
gataaggtattgacaacatttaaaatgaaatctgaatttgctgataataaggattttaga
gagttgttaatttgggcgaataaaaaaatccccaaccccaatgccaaagccaataatgca
gacagcctaaaagccaatccgcaaacgtttttattccaagttcactgcaatcaattgttg
caggaaacgcaatttaaagctgatgcaaatgatgaaatagccttgcaacttggcacgcaa
aataattttcctcgaaccataaaaatgagtgaaatggagcgacacatttttaataaagcc
ttgcatatcaaaggaaaaaatagtcaatctttatttcatttcgatcgcttgcaaagcaaa
ctcaacattcaaaatcgcaatgaattgcaaaataacttgttaaaagattggaaaattgaa
tttttgggattagggcaagataaacagattagcccagatgacaaacttgcaggctgccta
agaatcttggaaatggttgaaaaacgtctcaatgaaagtgataagccatttatcggtaca
aaagaatttacgcctaaaaaattgtgggaaatttttggcacaccaaaacaaaaatgggtc
aaaaaagatgatgtaaaaactgctattgccacgcaaaatgattggtatgtgatggataat
tttgctggaacgagtttggaagaagcgttaattcaatttatttcagagcgtttgggcgat
ttgaaatctcaatatgacgttcatttaatccgtaatgaagaagtgtttaaattgaataac
tttaccaatggtgaagggtttatgccagactttattttattgctaaaagataaacaaaaa
tcttcttccaatggtgtggatggctttttgcattaccaaattttcattgaaccgaaaggc
gggcatttagtggaaaatgatttgtggaaaaacgcttttttagaggcaatcacagtggaa
tatgggaagaataagattctgcaaaaagatacaccgcattatcgtttgatcggtttgccg
ttttttactgacaatcaggaaaacggagaatttacggagtcattccctttaggggaggca
tcgcttgaaaaatag

DBGET integrated database retrieval system