KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF12670Help
Entry
HIBPF12670        CDS       T01395                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:hif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIBPF12670
   01230 Biosynthesis of amino acids
    HIBPF12670
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIBPF12670
   00030 Pentose phosphate pathway
    HIBPF12670
   00051 Fructose and mannose metabolism
    HIBPF12670
   00052 Galactose metabolism
    HIBPF12670
  Energy metabolism
   00680 Methane metabolism
    HIBPF12670
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HIBPF12670
Enzymes [BR:hif01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HIBPF12670
Protein phosphatases and associated proteins [BR:hif01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HIBPF12670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1218778..1219743
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQLNRYSVSD
VINRGGTFLGSARFPEFKDPNIRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHRFP
CVGLPGTIDNDVAGTDYTIGYQTALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
SAGIAGGCEYIVASEIEFNREELIQQIERSIIRGKRHAIIAITELLTDVHSLAKEIEARV
GHETRATVLGHIQRGGSPCAFDRILASRMGAYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMQRVFKADWLKVAKRLE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgcagttttaacaagtggtggcgatgcgcctggtatgaatgccgca
attcgtggcgtagtacgttctgcacttgcagaaggcttagaagtatttggtatctatgac
ggttatcaaggtttatacaataataaaatcaaacaattaaatcgctatagcgtatctgat
gtgattaatcgtggcggtacttttttaggttctgcacgttttcctgaatttaaagatcct
aatattcgggcaaaatgtgcggaaattttacgttctcacggcattgatgcacttgtggtt
atcggtggtgacggttcttatatgggggcaaaattattaaccgaagaacaccgtttccct
tgtgttggcttacccggtactattgataatgatgttgcaggtactgactataccatcggt
tatcaaaccgcattacaaactgcagtggatgcaatcgaccgtttacgtgatacatcaagc
tcacaccaacgtatttctatcgttgaaattatgggtcgccactgtagtgacttaaccatt
tctgcgggcattgctggcggttgtgaatatatcgtcgcatcagaaattgaatttaatcgc
gaagaattaattcaacaaattgaacgtagcattattcgcggtaaacgccacgctattatt
gctatcactgaacttttaaccgatgttcattctctggcaaaagaaattgaagctcgcgta
ggtcacgaaactcgcgcaaccgttttagggcatattcaacgtggtggttctccttgtgct
tttgaccgtattcttgcctcacgtatgggcgcatacgcagtagatttattgctacaaggc
aaaggcggctattgcgtaggtatccaaaatgaacaactggttcatcacgatattattgat
gccattaataatatgcagcgtgtatttaaggctgattggcttaaagtggcaaaacgtttg
gaataa

DBGET integrated database retrieval system