KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF12880Help
Entry
HIBPF12880        CDS       T01395                                 

Definition
beta n-acetyl-glucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hif00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HIBPF12880
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    HIBPF12880
Enzymes [BR:hif01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HIBPF12880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1239017..1240072
Genome map
AA seq 351 aa AA seqDB search
MSSLLIDLNGKELEQEEVELLSHPLVAGLILFTRNFENREQIQELIRSVRQRVKKPLLIT
VDQEGGRVQRFRDGFTMLPSMQAFQETLSATEQVSFAKEAGWQMAAEMIALDIDLSFAPV
LDLGHECRAIGDRSFSSDIKSAVNLATAFIDGMHQAGMASTGKHFPGHGHVLADSHLETP
YDDRTKEEIFSGDLQPFQQLISQNKLDAIMPAHVIYSQCDSQPASGSKYWLKEILRKKLN
FQGTIFSDDLGMKGAGVMGNFVERSKKALNAGCDLLLLCNEREGVIQVLDNLKLTENQPH
FMARQARLQSLFKRRVINWNDLISDQRWKLNHRNLADIQSRWLDIQAAKND
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgttgttaattgatttaaacggaaaagagttggaacaagaggaagttgagtta
ctttctcaccctcttgttgcaggattaattttatttactcgaaattttgaaaacagagaa
caaattcaagaattaattcgttctgttcgccaacgagtgaaaaagcctttattgattacg
gtggatcaagaaggtggacgagttcaacgtttccgtgatggatttacaatgttgccttca
atgcaggcttttcaagaaacactgtcagcaactgaacaagtgagttttgctaaagaagca
ggttggcaaatggcagcagaaatgattgccttggatattgacttgagttttgctcctgtg
ttggatttggggcatgaatgccgagcgattggtgatcgcagtttttcatctgatataaaa
agtgcggtaaatttagccaccgcttttattgatggtatgcatcaagcaggtatggcatct
acaggtaaacattttcccggtcatggtcatgtattagccgattctcatttagaaacgcct
tatgatgatcgtacaaaagaagaaatttttagtggcgatctccaacctttccaacagttg
atttcacaaaataaactcgatgcgattatgcctgctcacgtgatttattcgcaatgtgat
agtcagcctgcaagtggttcaaaatattggttgaaagaaattttacgcaagaaattaaat
ttccaaggtacaattttttccgatgatctaggaatgaaaggcgcgggagtaatggggaat
tttgtagagcgtagtaaaaaagcactcaatgcaggttgcgatcttttattactgtgtaat
gaacgtgagggtgtcattcaagtattagataatctaaaacttactgaaaatcaaccgcac
tttatggctcgtcaagctcgcttacaaagtttatttaaacgtagagtgattaattggaac
gacttaatttcagatcaacgttggaaactgaatcaccgaaatctcgcagatattcaaagc
cgttggctagacattcaggcagcaaaaaatgattga

DBGET integrated database retrieval system