KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF14130Help
Entry
HIBPF14130        CDS       T01395                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hif00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:hif00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1332806..1333288
Genome map
AA seq 160 aa AA seqDB search
MTFSLIVATTLNSVIGKDNQMPWHLPADLARFRQNTTGKPVIMGRKTFESIGRPLPKRTN
IVLSRQPFEHEGVVWKDSLESAVDFVRDFDEIMLLGGGELFKQYLPQADKLYLTQIQAEL
DGDTFFPQLNWDEWKIEFDEYRKADEQNRYDCRFLILTRK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacatttagtttaattgtagcgacaacattaaatagtgtaattggtaaagataaccaa
atgccttggcacttgcctgcagatttagcaaggtttcgtcagaacacgacgggcaaacct
gtcatcatgggacgtaaaacgtttgaaagtattggtcgcccgctacctaaacggaccaat
attgtgctttctcgtcagccttttgaacacgaaggtgtggtatggaaagatagccttgaa
agtgcggtagattttgtcagagattttgatgaaattatgttgcttggtgggggagagtta
ttcaaacaatatttgccacaagcagataagttatatcttactcaaattcaggcagaacta
gatggtgatacttttttccctcaattgaattgggatgagtggaaaattgaatttgacgaa
tatcgtaaggctgatgaacaaaatcgctatgattgtcgatttttgattcttacccgaaaa
taa

DBGET integrated database retrieval system