KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF15540Help
Entry
HIBPF15540        CDS       T01395                                 

Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hif00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIBPF15540
   01230 Biosynthesis of amino acids
    HIBPF15540
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIBPF15540
  Energy metabolism
   00680 Methane metabolism
    HIBPF15540
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HIBPF15540
Enzymes [BR:hif01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HIBPF15540
Exosome [BR:hif04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HIBPF15540
  Exosomal proteins of melanoma cells
   HIBPF15540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1455001..1455684)
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKAAGKKLLDKGYEFDIAFTSVLTRA
IKTCNIVLEESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDPQDPNSAHNDRRYANIPSDVVPNAENLKLTLERALPFWEDQIAPAMLSGKRVLVVA
HGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDDKLNYVEHYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattagtatttatccgtcacggttttagtgaatggaatgcgaaaaacttattcaca
ggctggcgtgatgtgaatttaactgaacgtggtgtggaagaagcaaaagctgcgggtaaa
aaactgttagacaaaggttatgaatttgatatcgcatttacctctgttttaactcgagca
atcaaaacttgtaacatcgtgttagaagaatcccatcaattatggattccgcaagtaaaa
aactggcgtttaaatgaacgtcattatggtgctttacaaggtttagataaaaaagcgact
gcggagcaatacggtgacgaacaagttcatatttggcgtcgttcttacgacatttctcca
ccagatttagatccacaagatccaaattctgcacacaatgatcgtcgctacgcaaatatt
ccatctgatgttgtgccaaacgcagaaaatttaaaattaacattagaacgcgcattacca
ttctgggaagatcaaattgcaccagcaatgctttctggcaaacgtgttttagtagttgct
cacggtaattcacttcgtgcgttggcaaaacatattatcggtatttctgatgctgaaatt
atggattttgaaattccaacaggtcagcctttagttttaaaacttgatgataaattaaat
tacgtagaacattactatctttaa

DBGET integrated database retrieval system