KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF15960Help
Entry
HIBPF15960        CDS       T01395                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hif00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HIBPF15960
Enzymes [BR:hif01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     HIBPF15960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1513658..1515427
Genome map
AA seq 589 aa AA seqDB search
MALATQSNRIKIGIRPTIDGRQMGVRESLETQTIRMAQSVAQLLQTHIRHTDGTFVECVV
ADSTIGGVAEAAACADKFKRENVGLTITVTPCWCYGSETIDMDPHMPKAIWGFNGTERPG
AVYLAAALAGHSQLGLPAFSIYGTEVQEADDTNIPEDVKEKLLRFARAGLAVASIRGKSY
LSIGSVSMGIAGSIVNQAFFQEYLGMRNEYVDMMEIKRRLDRKIYDQEEVDLALSWVKQY
CKEGVDVNSLENQRNAEERAELWENVVKMTIITRDLMVGNPKLATLNYAEEALGHNAIAA
GFQGQRHWTDHLPNGDFMEAMLNSTYDWNGVRPPYILATENDSLNAIGMLFGHQLTGKAQ
IFADVRTYWSQDSVERVTGWRPESGFIHLINSGSAALDGTGEHQDAQGNPTLKPAWDVTE
EEAKRCLENTRWCPAVHEYFRGGGLSSQFLTKGGIPFTMHRINLIKGLGPVLQIAEGWSI
DLPQDVHNKLNQRTNETWPTTWFVPRLTGKGAFTDVYSVMANWGANHCVATHGHVGADLI
TLASMLRIPVCMHNVSEKNIFRPSAWNGFGQDKEGQDYRACQNFGPLYK
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgctactcaatcaaatcgtataaaaatcggtattcgtccaactattgatggt
cgtcaaatgggggttcgagaatctcttgaaacccaaacaatacgtatggctcaatctgtt
gctcaattattacaaacacatattcgtcatacagatggtactttcgttgaatgtgtagtt
gcagatagcactatcggcggtgtagccgaagcagccgcctgtgcggataaatttaaacgc
gaaaacgttggattaaccattaccgttaccccttgttggtgttatggctcagaaaccatt
gatatggatcctcacatgcctaaagcaatttggggatttaacggtacggaacgcccaggt
gcggtttacttggctgccgcccttgctggtcattctcaattaggactaccagccttttcc
atttacggcacagaagttcaagaagccgatgacacaaacattcctgaagatgtaaaagaa
aaattattgcgttttgctcgtgctgggcttgctgttgcaagtattcgaggaaaatcctat
ttatctattgggtcagtttccatgggaattgcaggttctattgtaaatcaagctttcttc
caagaatatttaggtatgcgtaatgaatatgtggatatgatggaaattaaacgccgttta
gaccgcaaaatttatgatcaagaagaagttgatttagccttgagttgggttaaacaatat
tgcaaagaaggggttgatgtaaatagcctagagaatcaacgcaatgcggaagagcgtgca
gaactttgggaaaatgttgtgaaaatgaccattatcactcgtgatttgatggtaggaaat
ccaaaattagcaacattaaattatgcagaagaagccttaggtcataatgccattgcagca
ggttttcaagggcagcgtcattggactgatcatttgccaaacggcgattttatggaggca
atgctcaattcaacttatgactggaatggcgtgcgtccaccttatattcttgccacggaa
aatgatagtttaaatgcaataggaatgttatttgggcatcaattaactggcaaagctcaa
attttcgcagatgtgcgtacttattggagtcaagattcggttgagcgtgttactggatgg
cgacctgaaagtggattcattcatttaatcaattcaggttcagctgcacttgatggaacg
ggagaacatcaagatgctcaaggcaatccaactttaaaaccagcatgggatgttaccgaa
gaagaagcaaaacgctgcttagaaaatacacgttggtgccctgctgttcacgaatatttt
cgagggggcggtttatcttctcaattcctaaccaaaggtggcataccgtttacaatgcac
cgtattaatcttattaaaggtttaggtcccgttttacaaattgcggaaggctggtcaatc
gacttacctcaagatgtacataataaattaaatcaacgtactaatgaaacttggccaaca
acatggtttgttccacgtttaactggaaaaggtgcatttactgatgtgtattcagtcatg
gcaaattggggcgcaaatcactgtgtagcgactcacggtcatgtgggggctgatctaatc
actcttgcttcaatgttacgcattccagtctgtatgcataatgtatcagagaaaaatatt
ttccgccctagtgcttggaatggatttggtcaagacaaggaagggcaagattatcgtgcc
tgccaaaactttggtccgctttataaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system