KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF15990Help
Entry
HIBPF15990        CDS       T01395                                 

Definition
l-fuculose-1-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hif00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HIBPF15990
Enzymes [BR:hif01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     HIBPF15990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1517381..1518031
Genome map
AA seq 216 aa AA seqDB search
MNRAELSQKIIDTCLEMTKLGLNQGTAGNVSVRYKDGMLITPTGMPYHLMKTENIVYVDG
NGKHEENKLPSSEWQFHLSVYHTRPEANAVVHNHSIHCAGLSILEKPIPAIHYMVAVSGT
DHIPCVPYATFGSHELASYVATGIKESKAILLAHHGLITCGENLDKALWLAQEVEVLASW
YLKLLSTGLEIPLLSKEQMQVVLGKFHTYGLRIEES
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagcagaattatcacaaaaaatcattgatacttgtcttgaaatgacaaaatta
ggtttaaatcaaggcacagcgggaaacgttagtgttcgttataaagatggaatgctgatt
accccgacaggtatgccatatcacttaatgaagacagaaaatattgtttatgttgatgga
aatggcaaacacgaagaaaataaattaccatcaagcgaatggcaatttcacttgagtgtt
tatcatactcgccctgaagcaaatgcagttgtccacaatcattccattcactgtgcaggc
ttatccattctcgaaaaacctattcctgcaattcattacatggtagccgtaagcggcaca
gatcatattccttgtgtaccttatgcaacatttggtagtcacgaattagctagttatgtc
gcaacgggaatcaaagaaagcaaagccattttactagcacaccatggtctaatcacttgc
ggagaaaacctagataaagccttatggctcgcacaagaagtagaagtattagcatcttgg
tatttgaaattactctctacaggcttagaaattccactgctcagcaaagagcaaatgcag
gtagtgttaggtaaattccacacctatggattacgtattgaagaatcctaa

DBGET integrated database retrieval system