KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF16360Help
Entry
HIBPF16360        CDS       T01395                                 

Definition
lysophospholipase l(2)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hif00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HIBPF16360
Enzymes [BR:hif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HIBPF16360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1562559..1563494
Genome map
AA seq 311 aa AA seqDB search
MIREPYFHQFALAKLLPFFEQFPTQYLSGKRNIKLAYRHLIQPESAVRKLMILVNGRAEN
MLKWSELAYDFYHQGYDVLLFDHRGQGYSQRIIHQKGHLDEFRFYVDDMAKIIEKVTALF
SYSTQHLLAHSMGALIATYYLANCDHCINKAVLSSPFYGIPLKHPIRDELIITLMNIFGQ
GERYVFGKGPYQQSHLEYNELSFCKTRMKWMNRVNRKNPAINLGGPTFRWVHLCLNAIKR
LPKVIPKIEIPILILQAEKEKIVDNNNLEKLTALFPNARCEVILNAKHEILFEQDKLRKE
TIFKMLEFLNN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgatcagagaaccttattttcatcaatttgctcttgcaaaattattgcctttttttgag
caatttcctacccaatatctttctggtaaacgaaatataaaattagcttatcgtcatttg
attcaacctgaaagtgcggtcagaaaattgatgattttagtaaatggtcgagcagaaaat
atgcttaaatggtcagagctcgcttatgatttttatcatcaaggttatgatgtattgcta
tttgatcatcgcggtcaaggctattcacagcgtattattcatcaaaaagggcatttagat
gaatttcgtttctatgtcgatgatatggcgaaaatcatcgaaaaagtaaccgcacttttc
agctattcaacgcagcatttgcttgctcattcaatgggcgcattgattgcaacctattat
ttggcaaattgtgatcattgcattaataaagcggtactttcttcgcctttttacggcatt
cctttaaaacaccctattagagatgaactgattattaccctaatgaatattttcggacaa
ggcgagcgttatgtttttggtaaagggccttatcaacaatcccacttggaatacaatgaa
ctaagtttctgtaaaaccagaatgaaatggatgaatcgtgtaaatcgtaaaaatccagca
attaatcttggcgggccaacattccgttgggtacacttgtgtttgaacgcaattaaacgc
ttgccgaaagttattcctaagattgaaattccaatcctaattttacaagccgaaaaagaa
aaaatagtagataacaacaatcttgaaaaattaaccgcactttttccgaatgctagatgt
gaagtcatattaaatgctaaacacgaaattctatttgaacaggacaaattaagaaaggaa
acaatctttaaaatgttagaatttttaaataattag

DBGET integrated database retrieval system