KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF16840Help
Entry
HIBPF16840        CDS       T01395                                 

Definition
type iii restriction-modification system endonuclease
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1613257..1616157)
Genome map
AA seq 966 aa AA seqDB search
MAGFTYEKNLSHQERAIESVLAVFDLVHLNKNVQTDENPLIEFVGSLKTDNLQKIQQANN
VGDIALSHSNVLDISMETGTGKTYTYTKTMFELNRELGVFKFIVVVPTLSIKAGTKNFLQ
SASLAEHFRKDFAGQYGETEIELYVVESQKNKAKKAFMPSEIVRFVQAEDKQKIHVLLIN
AGMINSDTMAGKDKGNDGSRLIKDKFSVPFEALASTNPFVIIDEPHKFPTSKKTWENIQK
FNAQFILRYGATFNNQFENLLYRLSAIDAFNDDLVKGIRAFTEQIDGDNGERIKLIDLDG
KEATFILDKQAFKLSKGENLNRIHQAISDLFVSEMNKSVLVLSNGIELKKSDTINPYSYS
DTVQDKMMRQAIREHFVLEKELLTRNGGRIKPLTLFFIDDIAGYRDEKNQLSGSLKTVFE
QMVKAELEHRLQTENDEFLRQYWQTALNDIAKTHGGYFSQDNSDKDDKIEQEVNEILHDK
ETLLSLANPRRFVFSKWTLREGWDNPNVFQICKLRSSGSETSKLQEVGRGLRLPVNEYMA
RVKDHAFFLNYFVDNSETDFVKKLTDEVNSAVVKPIVFTALTDELIKKIQTAYPDVSKKQ
IRNQLADLTDDDDVFLENGFAETKKLFPKAFESSGSLKDGKIKGSGEKVEKVKMRIAKYD
ELKALWETINQKALLQYKIKDEDEFLSLFIRYLKENADKFTATGIRTVQNKIRVDNGLLS
ATETRSLNDEVFEPINTLNYREFLLKLSQTALIQMQTLHKAFFALRDVLEISKFLNERTI
HTIKAGFDRWLLFNSFNAFEVGFSRVGGSVHPTKFTDNQGNALTEVNASDLGTQFDSGSP
LAEFLFESVFFDSELEHANITKNQVKEVIVFTKIPKNSIKIPVAGGGTYSPDFAYIIKTS
SGDRLNLIVESKNVPDNQSLRSEEQQKIKHAEKLFNLVASDTKIVFKTQFEKDEIVNIIK
NAQKQR
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggcaggttttacttacgaaaaaaatttatcccaccaagagcgagcgattgaatccgtt
ttggcagtgtttgaccttgtgcatttaaataaaaatgtgcaaacagatgaaaatccctta
attgaatttgtaggcagcctgaaaacggataatttgcaaaaaatccaacaagccaataac
gtgggcgatatagcgttatcccatagcaatgtgcttgatatttcaatggaaacggggaca
ggcaaaacttatacctacacaaaaacgatgtttgagctcaatcgtgagctgggcgtgttt
aaatttatcgtggttgtgcccactctttccattaaagcaggaacgaaaaactttttgcaa
agcgcgtcgcttgcagaacattttcgcaaggattttgcagggcaatatggcgaaacagaa
attgaattgtatgtagtagaaagccaaaaaaacaaagcaaaaaaagcctttatgccctct
gaaattgtgcgttttgtgcaagcagaagataagcagaaaattcacgttttattgattaac
gcaggcatgattaattccgacacaatggcgggaaaagataagggcaatgacggcagccgt
ttgattaaagataagttttctgtgccctttgaggccttggcttcaactaatccctttgtg
attattgatgaaccgcataagtttcctacaagcaaaaaaacgtgggaaaacatacagaaa
tttaatgcccaatttattttgcgttatggtgcaacctttaacaatcaatttgaaaatttg
ctttatcgattaagtgcgattgatgcatttaatgatgatttagtaaaaggcattcgtgca
tttactgaacaaattgacggagataatggcgagcggattaaactgattgatttagacggc
aaagaagcgacatttattttagataaacaagcatttaagttaagtaaaggcgaaaattta
aaccgtattcatcaagccattagcgatttatttgtctctgaaatgaataaaagcgtgctg
gtgttgagcaatggtattgagttaaaaaaaagcgataccatcaatccgtattcatacagc
gatactgtgcaggataaaatgatgcgacaagcaattagagaacattttgtcttggaaaaa
gaattgcttacgagaaatggcggacggattaaaccactgactttgtttttcattgatgat
attgctggctatcgtgatgagaaaaatcaactttcaggcagcctaaaaaccgtttttgag
caaatggtaaaagcggaattagaacatcgtttgcaaacagaaaatgatgaatttctacgc
caatattggcaaacggcattaaacgatattgccaaaactcacggcggttatttttcgcag
gataacagcgataaagatgacaaaattgagcaagaagtaaatgaaattttgcacgataaa
gaaaccttgttatcgcttgctaatccacgccgttttgtattttctaaatggacgttgcgt
gagggatgggacaatcctaatgtgtttcaaatttgcaaattgcgttctagtggctctgaa
acgagcaaattgcaggaagtcggtcgtggcttgcgtttacctgtaaatgaatatatggca
agagtaaaagatcacgcctttttcttgaattattttgtggataatagcgaaacagatttc
gttaaaaaattaactgatgaagtgaatagtgcggtggtaaaaccgattgtttttacggct
ttaactgatgaattaattaagaaaattcagacggcttatcctgatgtcagtaagaaacag
attcgcaatcaattagcagatttaaccgatgacgatgatgtctttttagaaaacggcttt
gctgaaacgaaaaaattattcccgaaagcctttgaaagttcaggcagcctgaaagatgga
aaaatcaaaggttcaggcgaaaaagttgaaaaagtcaaaatgcgtattgctaaatatgat
gaattaaaagccttatgggaaacgattaaccaaaaagccttgttgcaatacaaaataaaa
gatgaagatgaatttttgagtttgtttatccgttatctgaaagaaaatgcggataaattt
acggcaactggcatacgcaccgtacaaaataaaattcgtgtggataatggtttattgtct
gccactgaaacaagaagcctgaacgatgaagtttttgaaccgattaatacgctgaattat
cgtgagtttttattgaaattatctcaaacagctttgattcaaatgcagactttgcacaag
gcattttttgcgcttcgtgatgtgttggagatttcaaaattcctgaatgaacgcacgatt
cacacgataaaagcagggtttgaccgctggttattgttcaattcctttaatgcgtttgaa
gtaggatttagccgtgtgggtggcagtgttcacccaacaaaatttacggataatcaaggt
aatgcgctgacagaagtgaatgcttcggatttaggtacacagtttgattcgggtagccca
ttggctgaatttttgtttgaaagtgtgttttttgatagtgaattggaacacgcaaacatt
acgaaaaatcaagtaaaagaagtgattgtgtttaccaaaattcccaaaaattccatcaaa
atcccagtggcaggcggcggcacatactcgcccgattttgcttatattataaaaacaagc
tcgggcgatcggcttaatttgattgtagaaagtaagaatgtaccagacaatcaatcttta
cgttcggaagagcagcaaaaaattaaacacgcagaaaaattgtttaatctcgttgcatcg
gatacgaaaattgtgttcaaaacccaattcgagaaagatgaaattgttaatattataaaa
aatgcacagaaacaacgatga

DBGET integrated database retrieval system