KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF17690Help
Entry
HIBPF17690        CDS       T01395                                 

Definition
DNA-binding transcriptional regulator cysq
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hif00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    HIBPF17690
Enzymes [BR:hif01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     HIBPF17690
Transfer RNA biogenesis [BR:hif03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    HIBPF17690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1690865..1691674
Genome map
AA seq 269 aa AA seqDB search
MLALNEHLLNQVLLIAYQAGKHLQQFYQKQVHVELKEDNTPVTEADLFVSQFLTEKLTAL
FPNVPVLSEENCHISFEERKNWKEYWLIDPLDGTQQFINRTDQFSVLITLVRKNKPVLSV
IHAPILSTTYYAMDNFGTFKKQLDQVKKLTKNMTNFDRPLRIAVGATTSQEKVRSILPKD
FPCEFVVVGSSSLKSGLVAEGAVDCYVRLGRTGEWDTAGAEVLLGETHGAIFDSHFEPLT
YNQRETLINPHFVMVGDQSLDWRSIFQFN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgctaaacgaacatttacttaaccaagtattgctgattgcttaccaagcgggt
aagcatttgcaacagttttatcaaaaacaggttcatgttgaattgaaagaagacaacacg
cctgtgacggaagcggatctttttgtgagccaatttttaaccgaaaaattgaccgcactt
ttccctaatgtccccgttctttcggaagaaaattgccatatttcctttgaagaacgtaaa
aattggaaagaatattggttgattgatcctcttgatggcacacaacaatttattaatcgt
accgatcaattttctgtgttgataaccttagttcgtaaaaataaacccgtgttaagtgtt
attcatgcgccaattttatcgacaacttattatgcaatggataatttcggcacgtttaaa
aaacaactggatcaggtaaaaaaactcactaaaaacatgacaaattttgaccgcccttta
cgaattgcggtaggtgcaaccacttcacaagaaaaagtgcggtcgattttgccgaaggat
tttccttgtgaatttgttgtggttggttcaagtagcttaaaaagcggtttggtggctgaa
ggtgcagtagattgttatgttcgtttaggacgaacaggcgaatgggataccgctggtgct
gaagtgttactgggtgaaactcacggtgccatttttgactctcattttgagcctttaacc
tataaccaacgcgaaacattgattaatccgcattttgttatggtgggcgatcaatcgctc
gattggcgttctatctttcaatttaattga

DBGET integrated database retrieval system