KEGG   Haemophilus influenzae F3031 (nontypeable): HIBPF18890Help
Entry
HIBPF18890        CDS       T01395                                 

Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
hif  Haemophilus influenzae F3031 (nontypeable)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hif00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HIBPF18890
DNA repair and recombination proteins [BR:hif03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      HIBPF18890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1809505..1810107)
Genome map
AA seq 200 aa AA seqDB search
MQSSPLLEHLIENLRCLPGVGPKSAQRMAYHLLQRNRSGGMNLARALTEAMSKIGHCSQC
RDFTEEDTCNICNNPRRQNSGLLCVVEMPADIQAIEQTGQFSGRYFVLMGHLSPLDGIGP
REIGLDLLQKRLVEESFHEVILATNPTVEGDATANYIAEMCRQHNIKVSRIAHGIPVGGE
LETVDGTTLTHSFLGRRQID
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcagcccacttttagaacaccttattgaaaacttacgttgtcttccaggcgta
gggcctaaatctgcgcaacgtatggcttatcatcttttacagcgtaatcgtagcggtgga
atgaatttagctcgagcactcacagaagccatgtctaaaattggtcattgttcacaatgt
cgagactttacggaagaagacacttgcaacatttgcaataatccacgccgtcaaaattca
ggtttgctttgtgtcgttgaaatgcccgcagatattcaagcgattgagcaaacggggcaa
ttttcaggacgttattttgttttaatgggacatttgtctccacttgatggtattgggcct
cgtgaaattggcttagatttactgcaaaaacgcttagtagaagaatctttccacgaagtg
attcttgcaacaaatccgacggtggagggcgatgcgacggcaaactatattgctgaaatg
tgccgccaacataatatcaaagtgagtcgtatcgctcatggcattcctgtcggtggtgaa
ctggaaactgtggacggcacaacacttactcactcttttctaggtcgtcgtcaaatcgac
taa

DBGET integrated database retrieval system