KEGG   Haemophilus influenzae KR494 (serotype f): HifGL_000321Help
Entry
HifGL_000321      CDS       T02839                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
hik  Haemophilus influenzae KR494 (serotype f)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hik00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HifGL_000321 (tdk)
Enzymes [BR:hik01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HifGL_000321 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
326240..326791
Genome map
AA seq 183 aa AA seqDB search
MNAGKSTTLLQSSYNYRERDMNTLVYTAAIDDRFGVGKVTSRIGISQDAFLFRSETNLFD
EINEHIKKEKVHCVLVDEAQFLSKQQVYQLSDVVDKFKIPVLCYGLRTDFQAELFEGSKY
LLAWADQLEELKTICYCGRKANFVLRLNDQGEVIKEGAQIQIGGNDSYLSVCRLHYKEKC
GQI
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctggaaaatcaacgacgttgctacaatcttcctataattatcgtgagcgtgat
atgaatacattagtttatacggctgcgattgatgatcgttttggcgtggggaaagtcaca
tcgcgtattggtatttcgcaagatgcctttttatttcgctcggaaaccaatttgtttgat
gaaatcaatgaacacataaaaaaagaaaaagtacattgcgtgctggtggatgaagcgcaa
tttcttagcaaacaacaagtttaccagttgagtgatgttgttgataaattcaaaatccct
gtgctttgttatggcttgcgaacagatttccaagcggaactttttgaaggaagtaaatat
ttactggcttgggcggatcaactcgaagaattaaaaacaatttgttattgtggccgcaag
gctaactttgttttgcgcttaaatgatcaaggtgaggtcattaaagaaggtgcgcaaatt
caaattgggggcaatgactcttacctttctgtttgccgtttacactataaagaaaagtgc
ggacagatttaa

DBGET integrated database retrieval system