KEGG   Haemophilus influenzae KR494 (serotype f): HifGL_000446Help
Entry
HifGL_000446      CDS       T02839                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
hik  Haemophilus influenzae KR494 (serotype f)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:hik00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HifGL_000446 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    HifGL_000446 (atoB)
   00640 Propanoate metabolism
    HifGL_000446 (atoB)
   00650 Butanoate metabolism
    HifGL_000446 (atoB)
  Lipid metabolism
   00071 Fatty acid degradation
    HifGL_000446 (atoB)
   00072 Synthesis and degradation of ketone bodies
    HifGL_000446 (atoB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HifGL_000446 (atoB)
   00310 Lysine degradation
    HifGL_000446 (atoB)
   00380 Tryptophan metabolism
    HifGL_000446 (atoB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HifGL_000446 (atoB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HifGL_000446 (atoB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HifGL_000446 (atoB)
Enzymes [BR:hik01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HifGL_000446 (atoB)
Exosome [BR:hik04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HifGL_000446 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(459244..460425)
Genome map
AA seq 393 aa AA seqDB search
MENVVIISAVRTPIGSFNGALSSVSAVDLGAIVIQEAIKRANIESALVNEVIMGNVLQAG
LGQNPARQAALKAGIEKEIPSLTINKVCGSGLKSVALGAQSIISGDADIVVVGGMENMSQ
APYLLDSKVRQGVKMGNLTLRDTMIEDGLTCASNHYHMGITAENIAEQYGISRQAQDELA
LRSQTLASQAVQLGVFDKEIVPVMVKTRKGDIIVSRDEYPKADTTAEGLAKLKPAFKKEG
TVTAGNASGINDGAAALILVSESKAHALGLKAIAKIRSYASGGVDPSVMGLGPVPATQKA
LKKAGINLDDIDLIEANEAFASQFLGVGKDLNLDMNKTNIHGGAIALGHPIGASGARILV
TLLHNLIEKDKKLGLATLCIGGGQGISMIVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgttgttattattagtgcagttagaacaccgatcggcagctttaatggtgca
ttatcttccgtaagtgcggttgatttaggtgcaattgtgatacaagaagccatcaaacgt
gccaatattgaaagtgcattagttaatgaagtcatcatgggaaacgtattacaagcagga
ctagggcaaaatccagcccgtcaagcagcattaaaagcaggaatagagaaagaaatccct
tctttaacaatcaataaagtatgtggatctggtctaaaaagtgtcgcattaggtgcacag
tctattatcagtggtgatgctgatattgttgttgtgggtggcatggaaaatatgagccaa
gcaccttatcttttagatagcaaagtacgacaaggcgtcaaaatgggtaatctcacatta
agggacacaatgattgaagacggactaacttgtgctagcaatcactatcatatggggatt
actgccgaaaatattgcagaacaatatggcattagccgccaagcacaagatgaactcgca
ttacgttcacaaaccttagcatctcaagccgtgcaattaggtgtatttgataaggaaatt
gtccctgttatggtaaaaactcgcaaaggagacattattgtttcacgagacgagtatcct
aaagcagataccacagctgaaggtttagctaaattaaaacctgctttcaaaaaagagggt
actgtcaccgcaggtaacgcttctggcattaatgatggtgctgcagcacttattttagtt
agcgaaagcaaagctcatgcacttggattaaaagccattgcaaaaattagaagctatgcc
agcggtggggtagatccatctgttatgggattaggtccagttccagcaacgcaaaaagca
ttgaaaaaagcaggaataaatcttgatgatatcgatctgatagaagcaaatgaagccttt
gcctcacaattcttaggtgttggcaaagatctcaatttggatatgaataaaaccaatatt
catggtggagctatcgcacttgggcatccaatcggcgcgagtggtgcaaggattttagta
acgttattgcacaatcttatcgaaaaagataaaaaacttgggcttgctacactttgtatt
ggcggtggtcaaggtatttctatgattgtagaacgcttataa

DBGET integrated database retrieval system