KEGG   Haemophilus influenzae KR494 (serotype f): HifGL_001370Help
Entry
HifGL_001370      CDS       T02839                                 

Gene name
lys
Definition
phage-related lysozyme (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hik  Haemophilus influenzae KR494 (serotype f)
Brite
Enzymes [BR:hik01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     HifGL_001370 (lys)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1383420..1383938)
Genome map
AA seq 172 aa AA seqDB search
MIKRSAKYICAISAIVGLVIATHGNEIRTSEKGLLLIGNAEGCMKKPYQCPADVLTVGIG
ITDAVEKIDRNKIYTLQEIAELYVKGIKQSEKCVNQYANGQTMPQGAFDALVSITFNVGC
GKLKNSSLFKMARQGYSKAMCGQFERWIYAAGKVLKGLIERRQKEKNLCLIS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacgttcagctaaatacatctgcgccatatccgccattgttggacttgtgatt
gccactcatgggaatgaaattcgaacatcagaaaaaggcttgttactgattggcaatgca
gaaggttgcatgaaaaagccctatcaatgccctgccgatgttttaacagtcggcataggc
ataaccgatgccgttgaaaaaattgaccgcaataaaatttacaccttgcaagaaattgca
gagttatacgtaaaaggcattaaacaatcagaaaaatgcgttaatcaatacgccaacggg
caaactatgccacaaggtgcatttgatgccttagtgtccattacctttaacgtaggatgt
ggcaaattaaaaaatagctcactttttaaaatggcacgccaaggctacagcaaagccatg
tgcggtcagtttgagcgttggatttatgccgcaggaaaagtgctaaaaggcttaatcgaa
cgccgacaaaaggagaaaaacctatgtttaatttcttaa

DBGET integrated database retrieval system