KEGG   Haemophilus influenzae KR494 (serotype f): HifGL_001399Help
Entry
HifGL_001399      CDS       T02839                                 

Gene name
mrcB
Definition
penicillin-binding protein 1B
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
hik  Haemophilus influenzae KR494 (serotype f)
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:hik00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HifGL_001399 (mrcB)
Enzymes [BR:hik01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     HifGL_001399 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     HifGL_001399 (mrcB)
Glycosyltransferases [BR:hik01003]
 Polysaccharide
  Bacterial polysaccharide
   HifGL_001399 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1412204..1414549
Genome map
AA seq 781 aa AA seqDB search
MTSQHSAKKSSKNTPKNNRTFKGFLLKFSFTVLVLTIFYGGYLDWQIRSKMDGQIWHLPA
EVYSRLESVKIADNLAFDEVIQILLDNEYRQTTMVAAPGDFKLEDDSIVVLRRAFPFPDK
AEPQRVLRLRFSNNKLSLIEDLVTVKTVDEFRLAPKLIAMLQSDNEDRLAIPLQNYPRLL
IDTLILTEDRRFYEHNGINPVGILRALIANIRAGQTVQGGSTLTQQLVKNLFLSRERTIT
RKANEALMSLVLDWRYDKNRILETYLNEIYLGQNGDTQIHGFELASQFYFGRSIREISLD
QIALLVGMVKGPSLYNPWRNPQNALERRNIVLKLMLEHKMIGDELYQLLSQRPLGVQKKG
QISRKYPAFIQTLQADLRRELGEHKMSSLLGARIFSTMDLKQQAQAENAVVNTVSQLQLK
TKNPHLESAMIITDYRTGEIRAVVGGLQTQYAGFNRALMAKRQIGSLVKPSIYLTALSNP
EQFRLNTLINNQPITINVKGSPPWQPRNYDKKYSGSVMLMDALARSLNIPTVNIGMKVGL
SKVIDTQKAMGWDNVEIPKVPAMLLGSYTISPYDVTKLYQTIANQGGRISLTTVDSITDR
QGNLIFQHDKSVKQVVPQEAAFQTLFAMQQTVERGTARSLQKDYADLHLAGKTGTTNEAR
DTWFVGIDGKNISTVWLGRDDNGETKLTGASGALQIYKDYLNRTNIEKLAITPPATVKWV
GINQYGGWDCESYRTIPVWLNNGQNFCGEISSPSLTPTTETETPPQESLWDVLDNPNPPA
Q
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcaacactccgctaaaaaatcatcgaaaaacacgccaaaaaataaccgcact
tttaaaggttttttactgaaatttagtttcactgtgcttgtcttaacgattttttacggc
ggttatctcgattggcaaattcgttctaaaatggatggacaaatttggcatttgcctgcg
gaagtttatagtcgattagaaagtgtgaaaattgccgataatctcgcttttgatgaagtc
attcaaattttattagataacgaatatcgccaaaccacaatggttgccgcccctggcgat
ttcaagttagaagatgatagcattgtagtgcttcgccgtgcttttcctttccccgataaa
gcagaaccacaacgagttttacgtttgcgttttagcaataataagttatctctcattgaa
gatttagtcacagtcaaaactgttgatgaatttcgtcttgcaccaaaattgattgcgatg
ttgcaatcagacaacgaagatcgtttagctattcctttacaaaattatccccgtttatta
attgatacattaattttaacggaagatcgccgcttttatgaacataatggcattaatcca
gtggggattttacgcgcattaattgccaatattcgtgcaggtcaaacggtacagggcggc
agtacgctcactcaacaattagtcaaaaatttatttttatcacgtgaacgcaccattaca
cgcaaagccaacgaagccttgatgtcattggtgttagattggcgttacgataaaaaccgc
attctcgaaacctatctcaatgaaatttatctcggacaaaatggcgatacgcaaattcac
ggttttgaattagccagccaattttattttggtcgttcgattcgtgaaattagcttagat
caaattgcccttttagtggggatggtcaaagggccttcactttataatccgtggcgaaat
ccgcaaaacgccctcgaacgtcgcaacattgttttaaagctaatgcttgagcataaaatg
atcggcgatgaactttatcaattattaagtcagcgacctttaggtgtgcaaaagaaaggg
caaatctcgcgtaaataccctgcatttattcaaactttacaggcagatttacgccgtgaa
ctgggcgaacacaaaatgtcgagcttacttggcgcacgtattttttccacaatggattta
aaacaacaagcccaagcagaaaatgcagtggtcaataccgtttcgcaattacaactgaaa
acgaaaaatccccatttagaaagtgcaatgattataacggattatcgcacaggcgaaatt
cgtgccgtggttggcggtttacaaacccaatatgcaggctttaatcgtgcattaatggca
aaacgtcagattggttctttagtaaaaccttctatttatttgaccgcactttctaatcca
gaacagttccgtttaaataccctaattaataaccagccaattacgattaatgttaaaggt
agcccaccttggcagccacgcaactatgacaaaaaatatagcggttcggtaatgttaatg
gatgccttagcccgttctttaaatattccgacagtgaatattggaatgaaagtcggcttg
agtaaagttattgacacacaaaaagcgatgggctgggataatgtagaaattcctaaagtg
cctgcgatgttactcggttcttataccatctcgccttatgatgtcacaaaactttatcaa
actattgccaatcaaggggggcgaatttcgctcacaaccgtagatagcattactgatcgt
caaggtaacctaatttttcaacacgataaaagcgtaaaacaagtggtgccacaagaagcg
gcattccaaacattatttgcaatgcaacaaactgttgaacgaggcactgcacgtagtttg
caaaaagattacgcagatttacatttagcaggcaaaacaggcacaaccaatgaagctcgc
gatacgtggtttgtgggaattgacggaaaaaatatcagcacagtttggcttggtcgcgat
gataatggcgaaacaaaactgactggtgcttctggcgcattgcaaatttataaagattat
ttaaaccgtacgaatattgaaaaattagcaattacgcctcctgcaacagtgaaatgggtg
gggataaatcaatacggtggctgggattgtgagagttatcgaacaattcctgtttggcta
aataatggtcagaatttctgtggagaaatatcatctccctctctcacgccaacaactgaa
acagaaacaccaccacaagaaagcctgtgggacgtattggataatcccaatccacccgct
caataa

DBGET integrated database retrieval system