KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_00380Help
Entry
HICON_00380       CDS       T01400                                 

Definition
4-diphosphocytidyl-2-methyl-D-erythritol synthase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HICON_00380
Enzymes [BR:hil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HICON_00380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1728619..1729572
Genome map
AA seq 317 aa AA seqDB search
MNTLMKSHQFSTALCQNTTQSNGQPLRFPSPAKLNLFLYINGKLPNGYHELQTLFQFLDF
GDWLDISIREQDNQIVLTPEIPNLKTEDNLIYRATKLLQEKANIQLGANIHLDKILPMGG
GVGGGSSNAATALLALNYLWQANLSIDDLAKLGLTLGADVPIFVHGQAAFAEGVGEKITY
CEPVEKWFVVLKPDDSISTAVIFQDPNLPRNTPKKSLEQLLSEPYKNDCEKVVINHYSNV
EKALNWLLQYAPARLTGTGACVFAEFDNEAEAQAVFRQKPKEFFGFVAKGLNVSPLHAML
KQLSSTHTHRQSKPEVL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaatacattaatgaaatcacatcaattttctaccgcactttgccaaaatacaacacaa
tcaaatgggcagccattacgcttccctagcccagcaaaactgaatttatttctttatatc
aatggaaaattgccgaacggctatcatgaattacaaacgcttttccaatttttagatttt
ggcgattggttagacattagtattcgggaacaagataatcaaattgttttaacgccagaa
attccaaatctaaaaacggaagataatctaatttatcgagctacaaaacttttacaagaa
aaagccaatattcaacttggtgcaaatatccatttagataaaattcttccaatgggaggc
ggtgttggtggtggttcatctaatgcagcaaccgcattgctcgctttaaattatttatgg
caagccaatttatccattgatgatctggcaaaattaggcttaacactaggtgctgatgtg
ccaatatttgtacatggacaggctgcttttgctgaaggtgtcggggaaaaaatcacttac
tgtgaacctgttgaaaaatggtttgttgtattaaaacccgatgattcaatatcaacggct
gtcatctttcaagatccaaatttaccacgtaatacgccgaaaaaatcccttgagcaactt
ttgagtgaaccttataaaaacgattgcgaaaaagttgtgataaatcattattcaaacgtt
gaaaaagcgttaaactggttgctacaatatgcgccagcaagattaacaggaacgggagcc
tgtgtttttgcagaatttgataatgaagcagaagcgcaagcggtatttagacaaaaacca
aaagaattttttggttttgtcgctaaaggactcaatgtgtctcccttgcacgcaatgttg
aagcagctatcatcaacccatactcatcgacaatctaaacctgaggttttataa

DBGET integrated database retrieval system