KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_03400Help
Entry
HICON_03400       CDS       T01400                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HICON_03400
Enzymes [BR:hil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HICON_03400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
62769..63251
Genome map
AA seq 160 aa AA seqDB search
MITAYIALGSNLNTPVEQLHAALKAISQLPNTHLVTTSSFYKSKPLGPQDQPDYVNAVAK
IETELSPLKLLDELQRIENEQGRVRLRLWGERTLDLDILLYGNEIIQNERLTIPHYDMHN
REFVIVPLFEIASDLVLPNSQIITELVKQFADHKMIKLNP
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattactgcatatattgctctaggtagcaatttaaacacaccagtagaacaattacat
gctgcgcttaaagcgataagtcagttaccaaacacgcatttagtaacgacgagctctttt
tataaaagcaaaccgctcggcccacaagatcaacccgattatgtgaatgccgttgcaaaa
attgaaaccgaacttagtccgctcaagctattagatgaattacagcgtattgaaaacgag
caaggtcgagtgcgtttacgtctctggggcgaacgcacgttagatttagatattttgctc
tacggcaatgaaattattcaaaacgaacgcttaacaattccccattatgatatgcataac
cgtgagtttgtcattgtgccgttgtttgaaatcgcatcggatttagttttaccaaatagt
caaatcataacagagctggtcaagcaatttgctgaccacaaaatgataaaattaaatccc
tag

DBGET integrated database retrieval system