KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_03600Help
Entry
HICON_03600       CDS       T01400                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HICON_03600
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HICON_03600
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HICON_03600
Enzymes [BR:hil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HICON_03600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(85585..86862)
Genome map
AA seq 425 aa AA seqDB search
MNLYNIKHPEEQVTFSQAVRQGLGRDQGLFFPEVIPKLNNINELLELPLVERSQKILGAL
IDGELPQATLDAMVKNAFTFPAPLEKVEDNIYALELFHGPTLAFKDFGGRFMAQALAAVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAI
NADFDACQALVKQAFDDVELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKEERDNVV
VSVPSGNFGNLTAGLIAKTLGLPIKRFVASTNANDTVPRYLKSGNWEPKTTVATLSNAMD
VSRPNNWPRVEELFKRNGWDLTDLGSGMLSDSETEDSLKAMQSKGYLCEPHGAIAYQVLK
DQLKASETGIFLCTAHPAKFKESVERILGIQLPLPETLDKHNQLPLLSDEMDNDFAQLRA
YLLKS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaatatcaaacacccagaagaacaagtcactttttctcaggctgttcgt
caaggtcttgggcgggatcaaggtttattctttccagaagttattcctaaacttaataac
attaatgaattacttgaattgcctcttgttgagcgtagtcaaaaaattctaggtgcatta
attgatggcgagttaccacaagcaacgttagatgcgatggtgaaaaatgcattcactttt
cctgcaccgttagaaaaagtggaagataatatttatgcacttgagttatttcacggtcca
acgctagcatttaaagattttggtgggcgttttatggctcaggcgcttgcagcagttcgt
ggtgatggcaaaattactattttaacggctacgtctggagatactggagccgctgtagca
catgcgttttatggattagaaaatattaatgtagttatcctttatccaaaaggcaaaatc
agcccattacaagaaaagctattctgtactttaggtgggaatattcgtactgttgctatt
aacgctgatttcgatgcgtgtcaggctttggttaagcaagcctttgatgatgttgaattg
cgccaagctatcgggctgaactctgcaaattctattaatatcagccgtttattagctcaa
gtttgttattactttgaggctgtcgcacaattgccaaaagaagaacgtgataatgtcgtg
gtttctgtgccaagtggtaattttggtaacttaactgcgggattaattgcaaaaacctta
ggcttgccgataaaacgctttgtcgcctcaacaaacgcaaatgatactgtgccacgttat
ttgaaatcgggtaattgggagcctaaaacgacagttgcaaccctttctaatgcaatggat
gtaagtcgcccaaataattggccgagagtggaggaattgtttaaacgaaatggttgggat
ttaactgatttaggttcggggatgctaagtgatagcgaaacagaagatagcttaaaagcg
atgcagtcgaaaggttatttatgtgaacctcacggtgcgatagcttatcaggtgttgaaa
gatcaacttaaagcgagtgaaacaggaatcttcctgtgtacggcgcatcctgcgaaattt
aaagaatccgtagaacgtattcttggtattcagcttccattacctgaaacactggataaa
cataatcagctaccattgctttctgatgaaatggataatgattttgcacaactacgggct
tacttattgaagtcataa

DBGET integrated database retrieval system