KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_03600Help
Entry
HICON_03600       CDS       T01400                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HICON_03600
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HICON_03600
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HICON_03600
Enzymes [BR:hil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HICON_03600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(85585..86862)
Genome map
AA seq 425 aa AA seqDB search
MNLYNIKHPEEQVTFSQAVRQGLGRDQGLFFPEVIPKLNNINELLELPLVERSQKILGAL
IDGELPQATLDAMVKNAFTFPAPLEKVEDNIYALELFHGPTLAFKDFGGRFMAQALAAVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAI
NADFDACQALVKQAFDDVELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKEERDNVV
VSVPSGNFGNLTAGLIAKTLGLPIKRFVASTNANDTVPRYLKSGNWEPKTTVATLSNAMD
VSRPNNWPRVEELFKRNGWDLTDLGSGMLSDSETEDSLKAMQSKGYLCEPHGAIAYQVLK
DQLKASETGIFLCTAHPAKFKESVERILGIQLPLPETLDKHNQLPLLSDEMDNDFAQLRA
YLLKS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaatatcaaacacccagaagaacaagtcactttttctcaggctgttcgt
caaggtcttgggcgggatcaaggtttattctttccagaagttattcctaaacttaataac
attaatgaattacttgaattgcctcttgttgagcgtagtcaaaaaattctaggtgcatta
attgatggcgagttaccacaagcaacgttagatgcgatggtgaaaaatgcattcactttt
cctgcaccgttagaaaaagtggaagataatatttatgcacttgagttatttcacggtcca
acgctagcatttaaagattttggtgggcgttttatggctcaggcgcttgcagcagttcgt
ggtgatggcaaaattactattttaacggctacgtctggagatactggagccgctgtagca
catgcgttttatggattagaaaatattaatgtagttatcctttatccaaaaggcaaaatc
agcccattacaagaaaagctattctgtactttaggtgggaatattcgtactgttgctatt
aacgctgatttcgatgcgtgtcaggctttggttaagcaagcctttgatgatgttgaattg
cgccaagctatcgggctgaactctgcaaattctattaatatcagccgtttattagctcaa
gtttgttattactttgaggctgtcgcacaattgccaaaagaagaacgtgataatgtcgtg
gtttctgtgccaagtggtaattttggtaacttaactgcgggattaattgcaaaaacctta
ggcttgccgataaaacgctttgtcgcctcaacaaacgcaaatgatactgtgccacgttat
ttgaaatcgggtaattgggagcctaaaacgacagttgcaaccctttctaatgcaatggat
gtaagtcgcccaaataattggccgagagtggaggaattgtttaaacgaaatggttgggat
ttaactgatttaggttcggggatgctaagtgatagcgaaacagaagatagcttaaaagcg
atgcagtcgaaaggttatttatgtgaacctcacggtgcgatagcttatcaggtgttgaaa
gatcaacttaaagcgagtgaaacaggaatcttcctgtgtacggcgcatcctgcgaaattt
aaagaatccgtagaacgtattcttggtattcagcttccattacctgaaacactggataaa
cataatcagctaccattgctttctgatgaaatggataatgattttgcacaactacgggct
tacttattgaagtcataa

DBGET integrated database retrieval system