KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_05860Help
Entry
HICON_05860       CDS       T01400                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hil00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hil00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
336860..337882
Genome map
AA seq 340 aa AA seqDB search
MLEQTTFNAPDGAPYQLITLQNENGMRVQFMDWGATWLSCKVPVNDTLREVLLGCKVENY
PTHQSYLGASVGRYANRIANAQFELNGELIKLSSNQGKHQLHGGEGFDKRRWKIQECGEN
FVCFSLQSEHGDQGFPGNVDVSVTYTLTDDNSVKIEYAGICDKDTALNLTNHAYFNLENA
EQGSDVREHTLRLNADFYLPVDNEGIPNSPLKHVVNTSFDFRIAKPIKQDFLQGDQQATK
GYDHSFIVNKAWQKPCVLLTSPTGDLSLEVRTSQAALQVYTGNYLAGTPTRNGELYADFS
GIALETQCLPDTPNHPEWQNYGGIQKASEQYYQWTEFKFK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaaaccacttttaatgcgcctgatggtgcaccttatcagcttataaccctg
caaaatgaaaatgggatgcgtgttcaatttatggattggggcgcaacttggctttcttgt
aaagtgccagtaaatgacacattacgcgaggttttattgggttgtaaggtagagaattac
cccactcatcaaagctatttaggcgcaagcgtagggcgttatgcaaatcgtattgcaaat
gcacaatttgaattgaatggcgaacttattaaattaagtagtaatcaaggaaagcaccag
cttcatggtggagagggttttgataaacgtcgttggaaaattcaagagtgcggtgagaat
tttgtgtgtttttcattacagtcagagcatggtgatcagggttttcctgggaatgtggat
gtgtctgtaacctatacgctaacagatgataatagcgtaaaaattgaatatgcagggatt
tgtgataaggataccgcattgaacctaacgaatcacgcctatttcaatttagaaaatgca
gagcaaggcagtgacgtgcgtgaacatacattacgtttaaatgctgatttttatctgcct
gtagataatgaggggattcctaattctccattaaagcacgtagtgaatacgagttttgac
ttccgtattgctaaacccatcaagcaagattttttacaaggggatcagcaagcaacaaaa
ggttacgatcattcctttattgtcaataaagcttggcaaaagccttgtgtgttactaacc
tctccaactggcgatttaagtttggaagtaagaacctcgcaagctgcattgcaggtttat
acgggtaattatcttgcaggtacaccaacgagaaatggcgaattatatgccgatttttct
ggcatagcactagaaacccaatgtttacccgacacgccaaatcatcctgaatggcaaaat
tacggcggaattcaaaaagcaagcgagcaatattatcaatggacagagtttaaatttaaa
taa

DBGET integrated database retrieval system