KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_05920Help
Entry
HICON_05920       CDS       T01400                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HICON_05920 (galU)
   00052 Galactose metabolism
    HICON_05920 (galU)
   00500 Starch and sucrose metabolism
    HICON_05920 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HICON_05920 (galU)
Enzymes [BR:hil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HICON_05920 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
343535..344422
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSICPKNVTIMHVRQGNARGLGHAVLCGRPLVGN
ESFAVMLPDVLLAEFSADQKKENLAAMIQRFNETGASQIMVTPVPQENVSSYGVADCGGI
ELNGGESAKINSIVEKPSIEDAPSNLAVVGRYVFSAAIWDLLEKTPIGVGDEIQLTDAID
MLIEKETVEAFHMTGETFDCGDKIGYMEAFVEYGIRHEKLGKEFKSFIKNLAKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattattcctgtcgccggtcttggcacacgtatgttgcccgccacgaaggcg
attccgaaggaaatgctcactttggtggataaaccgttaattcaatacgtggtaaatgaa
tgtgtagctgctggcataaaagaaattgtgctggtaacacattcatcaaaaaatgctatc
gaaaaccattttgatacatcttttgaattagaaacgatgctggaaaaacgtgtgaagcgt
cagcttctagaagaagttcgttctatctgtccaaaaaatgtaaccattatgcacgttcgt
caaggtaatgcgagaggtttaggtcacgccgtgttatgcggtcgtcctttagtaggaaat
gaatcttttgccgttatgttaccagatgtattattagctgaatttagtgcagatcagaaa
aaagaaaatcttgctgcaatgattcaacgctttaatgaaactggcgcaagccaaattatg
gtaaccccagttccgcaagaaaatgtgagtagctatggtgttgcagattgtggtggcatt
gagcttaatggcggcgaaagtgcaaaaattaatagtattgttgaaaaaccttctattgaa
gacgcaccatcaaatcttgctgtggttgggcgttatgttttttcagcagcaatttgggat
ttgttagaaaaaacaccaattggtgttggcgatgaaatccaattaaccgatgctattgat
atgctcattgaaaaagaaaccgttgaagcatttcatatgacaggggaaacttttgattgt
ggtgataaaattggctatatggaagctttcgtagaatatggtattcgtcacgaaaaatta
ggtaaagaatttaaatcctttatcaaaaatttggcaaaaacgctataa

DBGET integrated database retrieval system