KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_06840Help
Entry
HICON_06840       CDS       T01400                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hil00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
438801..440570
Genome map
AA seq 589 aa AA seqDB search
MALATQSNRIKIGIRPTIDGRRMGVRESLETQTIRMAQSVAQLLQTHIRHTDGTFVECVV
ADSTIGGVAEAAACADKFKRENVGLTITVTPCWCYGSETIDMDPHMPKAIWGFNGTERPG
AVYLAAALAGHSQLGLPAFSIYGTEVQEADDTNIPEDVKEKLLRFARAGLAVASIRGKSY
LSIGSVSMGIAGSIVNQAFFQEYLGMRNEYVDMMEIKRRLDRKIYDQEEVDLALSWVKQY
CKEGVDVNSLENQLNAEERAELWENVVKMTIITRDLMVGNPKLATLNYAEEALGHNAIAA
GFQGQRHWTDHLPNGDFMEAMLNSTYDWNGVRPPYILATENDSLNAIGMLFGHQLTGKAQ
IFADVRTYWSQDSVERVTGWRPESGFIHLINSGSAALDGTGEHQDAQGNPTLKPAWDVTE
EEAKRCLENTRWCPAVHEYFRGGGLSSQFLTKGGIPFTMHRINLIKGLGPVLQIAEGWSI
DLPQDVHNKLNQRTNETWPTTWFVPRLTGKGAFTDVYSVMANWGANHCVATHGHVGADLI
TLASMLRIPVCMHNVSEKNIFRPSAWNGFGQDKEGQDYRACQNFGPLYK
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgctactcaatcaaatcgtataaaaatcggtattcgtccaactattgatggt
cgtcgaatgggggttcgagaatctcttgaaacccaaacaatacgtatggctcaatctgtt
gctcaattattacaaacacatattcgtcatacagatggtactttcgttgaatgtgtagtt
gcagatagcactatcggcggtgtagccgaagcagccgcctgtgcggataaatttaaacgc
gaaaacgttggattaaccattaccgttaccccttgttggtgttatggctcagaaaccatt
gatatggatcctcacatgcctaaagcaatttggggatttaacggtacggaacgcccaggt
gcggtttacttggctgccgcccttgctggtcattctcaattaggactaccagccttttcc
atttacggcacagaagttcaagaagccgatgacacaaacattcctgaagatgtaaaagaa
aaattattgcgttttgctcgtgctgggcttgctgttgcaagtattcgaggaaaatcctat
ttatctattgggtcagtttccatgggaattgcaggttctattgtaaatcaagctttcttc
caagaatatttaggtatgcgtaatgaatatgtggatatgatggaaattaaacgccgttta
gaccgcaaaatttatgatcaagaagaagttgatttagccttgagttgggttaaacaatat
tgcaaagaaggggttgatgtaaatagcctagagaatcaactcaatgcggaagagcgtgca
gaactttgggaaaatgttgtgaaaatgaccattatcactcgtgatttgatggtaggaaat
ccaaaattagcaacattaaattatgcagaagaagccttaggtcataatgccattgcagca
ggttttcaagggcagcgtcattggactgatcatttgccaaacggcgattttatggaggca
atgctcaattcaacttatgactggaatggcgtgcgtccaccttatattcttgccacggaa
aatgatagtttaaatgcaataggaatgttatttgggcatcaattaactggcaaagctcaa
attttcgcagatgtgcgtacttattggagccaagattcggttgagcgtgtcactggatgg
cgacctgaaagtggattcattcatctaatcaattcaggttcagctgcacttgatggaacg
ggagaacatcaagatgctcaaggcaatccaactttaaaaccagcatgggatgttaccgaa
gaagaagcaaaacgctgcttagaaaatacacgttggtgccctgctgttcacgaatatttt
cgagggggcggtttatcttctcaattcctaaccaaaggtggcataccgtttacaatgcac
cgtattaatcttattaaaggtttaggtcccgttttacaaattgcggaaggctggtcaatc
gacttacctcaagatgtacataataaattaaatcaacgtactaatgaaacttggccaaca
acatggtttgttccacgtttaactggaaaaggtgcatttactgatgtgtattcagtcatg
gcaaattggggagcaaatcactgtgtagcgactcacggtcatgtgggggctgatctaatc
actcttgcttcaatgttacgcattccagtctgtatgcataatgtatcagagaaaaatatt
ttccgccctagcgcttggaatggatttggtcaagacaaggaagggcaagattatcgagct
tgccaaaactttggtccgctttataaataa

DBGET integrated database retrieval system