KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_07040Help
Entry
HICON_07040       CDS       T01400                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
464698..465216
Genome map
AA seq 172 aa AA seqDB search
MIKRSAKYLCAISAVVGLVIATHGNEIRTSEKGLLLIGNAEGCMKKPYQCPADVLTVGIG
ITDAVEKIDRNKIYTLQEIAELYVKGIKQSEKCVNQYANGQTMPQGAFDALVSITFNVGC
GKLKNSSLFKMARQGYSKAMCGQFERWIYAAGKPLKGLIERRQKEKNLCLIS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgattaaacgttccgccaaatacctctgtgccatatccgctgttgttggacttgtgatt
gccactcatggaaatgaaattcgaacatccgaaaaaggcttgttactgattggcaatgca
gaaggttgtatgaaaaagccctatcaatgccctgccgatgttttaacagtcggcataggc
ataaccgatgccgttgaaaaaattgaccgcaataaaatttacaccttgcaagaaattgcc
gaattatacgtaaaaggcattaaacaatcagaaaaatgcgttaatcaatatgccaacggt
caaaccatgccacaaggtgcatttgatgccttagtttccatcacctttaacgtaggatgc
ggcaaattaaaaaatagctcactttttaaaatggcacgccaaggctacagcaaagccatg
tgcggtcaattcgaacgttggatttatgcagcaggaaaaccgctaaaaggattaattgaa
cgccgtcaaaaggagaaaaacctatgtttaatttcttaa

DBGET integrated database retrieval system