KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_07520Help
Entry
HICON_07520       CDS       T01400                                 

Definition
lysophospholipase L(2)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hil00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
524806..>525693
Genome map
AA seq 296 aa AA seqDB search
MIREPYFHQFALAELLPFFEQFPTQYLSGKRNIKLAYRHLIQPESAVRKLMILVNGRAEN
MLKWSELAYDFYHQGYDVLLFDHRGQGYSQRIIPQKGHLDEFRFYIDDMAKIIEKVTALF
SYSTQHLLAHSMGALIATYYLANYDHHINKAVLSSPFYGILLKHPIRDELIITLMNILGQ
GERYVFGKGPYQQAHLEYNELTFCKTRMKWMNRVNRKNPAINLGGPTFRWVHLCLNAIKR
LPKVIPKIEIPILILQAEKEKIVDNKNLEKLTALFPNARCEVVFNAKHEVLFEKDN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgatcagagaaccttattttcatcaatttgctcttgcagaattattgcctttttttgag
caatttcctacccaatatctttctggtaaacgaaatataaaattagcttatcgtcatttg
attcaacctgaaagtgcggtcagaaaattgatgattttagtaaatggtcgtgctgaaaat
atgttgaaatggtcagagctcgcttatgatttttatcatcaaggttatgatgtattgcta
tttgatcatcgcggtcaaggctattcacagcgtattattcctcaaaaagggcatttagat
gaatttcgtttctatatcgatgatatggcgaaaatcatcgaaaaagtaaccgcacttttc
agctattcaacgcagcatttgcttgctcattcaatgggcgcattgattgcaacctattat
ttggcaaattatgatcatcacattaataaagcggtactttcttcgcctttttacggtatt
cttttaaaacatccaattagagatgaactgattattaccctaatgaatattttaggacaa
ggcgagcgttatgtttttggtaaagggccttatcaacaagcccacttggaatacaatgaa
ttaactttctgtaaaaccagaatgaaatggatgaatcgtgtaaatcgtaaaaatccagca
attaatcttggcgggccaacattccgttgggtacatttgtgtttgaacgcaattaaacgc
ttgccgaaagttattcctaagattgaaattccaatcctaattttacaagccgaaaaagaa
aaaatagtagataacaaaaatcttgaaaaattaaccgcactttttccgaatgctagatgt
gaagttgtattcaatgctaaacatgaggtgttatttgaaaaagataat

DBGET integrated database retrieval system