KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_07520Help
Entry
HICON_07520       CDS       T01400                                 

Definition
lysophospholipase L(2)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HICON_07520
Enzymes [BR:hil01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HICON_07520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
524806..>525693
Genome map
AA seq 296 aa AA seqDB search
MIREPYFHQFALAELLPFFEQFPTQYLSGKRNIKLAYRHLIQPESAVRKLMILVNGRAEN
MLKWSELAYDFYHQGYDVLLFDHRGQGYSQRIIPQKGHLDEFRFYIDDMAKIIEKVTALF
SYSTQHLLAHSMGALIATYYLANYDHHINKAVLSSPFYGILLKHPIRDELIITLMNILGQ
GERYVFGKGPYQQAHLEYNELTFCKTRMKWMNRVNRKNPAINLGGPTFRWVHLCLNAIKR
LPKVIPKIEIPILILQAEKEKIVDNKNLEKLTALFPNARCEVVFNAKHEVLFEKDN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgatcagagaaccttattttcatcaatttgctcttgcagaattattgcctttttttgag
caatttcctacccaatatctttctggtaaacgaaatataaaattagcttatcgtcatttg
attcaacctgaaagtgcggtcagaaaattgatgattttagtaaatggtcgtgctgaaaat
atgttgaaatggtcagagctcgcttatgatttttatcatcaaggttatgatgtattgcta
tttgatcatcgcggtcaaggctattcacagcgtattattcctcaaaaagggcatttagat
gaatttcgtttctatatcgatgatatggcgaaaatcatcgaaaaagtaaccgcacttttc
agctattcaacgcagcatttgcttgctcattcaatgggcgcattgattgcaacctattat
ttggcaaattatgatcatcacattaataaagcggtactttcttcgcctttttacggtatt
cttttaaaacatccaattagagatgaactgattattaccctaatgaatattttaggacaa
ggcgagcgttatgtttttggtaaagggccttatcaacaagcccacttggaatacaatgaa
ttaactttctgtaaaaccagaatgaaatggatgaatcgtgtaaatcgtaaaaatccagca
attaatcttggcgggccaacattccgttgggtacatttgtgtttgaacgcaattaaacgc
ttgccgaaagttattcctaagattgaaattccaatcctaattttacaagccgaaaaagaa
aaaatagtagataacaaaaatcttgaaaaattaaccgcactttttccgaatgctagatgt
gaagttgtattcaatgctaaacatgaggtgttatttgaaaaagataat

DBGET integrated database retrieval system