KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_08100Help
Entry
HICON_08100       CDS       T01400                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
hil00010  Glycolysis / Gluconeogenesis
hil00051  Fructose and mannose metabolism
hil00562  Inositol phosphate metabolism
hil01100  Metabolic pathways
hil01110  Biosynthesis of secondary metabolites
hil01120  Microbial metabolism in diverse environments
hil01130  Biosynthesis of antibiotics
hil01200  Carbon metabolism
hil01230  Biosynthesis of amino acids
Module
hil_M00002  Glycolysis, core module involving three-carbon compounds
hil_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HICON_08100
   00051 Fructose and mannose metabolism
    HICON_08100
   00562 Inositol phosphate metabolism
    HICON_08100
Enzymes [BR:hil01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HICON_08100
Exosome [BR:hil04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HICON_08100
  Exosomal proteins of bladder cancer cells
   HICON_08100
  Exosomal proteins of melanoma cells
   HICON_08100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBY86276
Position
complement(597883..598674)
Genome map
AA seq 263 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELIEGLKAELHDVTGCDVAIAPPVMYLGTAEAALSGCGC
SCGGKSVIQLGAQNVDINVKGAFTGDISSEMLKDFGAKYIIIGHSERRTYHKESDEFVAK
KFGALKEAGLVPVLCIGESEAENEAGKTEEVCARQIDAVINALGVEAFNGAVIAYEPIWA
IGTGKSATPAQAQAVHAFIRGHIAAKSQAVAEQVIIQYGGSVNDANAAELFTQPDIDGAL
VGGASLKAPAFAVIVKAAAAAKN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcattcacg
aaagaattaatcgagggattaaaagcggaattacatgatgtaacaggttgtgatgtagca
attgccccccccgttatgtatttaggtacggctgaagcagcactttctggttgtggttgc
agctgtggcggtaaaagtgtgattcaattaggtgcacaaaacgtagatatcaatgtgaaa
ggtgcatttactggtgatatttctagcgaaatgttaaaagatttcggtgcaaaatatatc
attattggccactctgaacgccgcacttatcataaagaaagcgacgaatttgtggcgaaa
aaatttggtgcattaaaagaagctggtttagtgccagtattatgtattggtgaatctgaa
gcagaaaacgaagcaggcaaaactgaagaagtgtgcgcgcgtcaaattgatgcggtgatc
aatgcgttaggtgtagaagcattcaacggtgcagtgatcgcatacgaaccaatctgggca
attggcacgggtaaatctgcaactccagcacaagcgcaagcagttcacgcatttatccgt
ggtcacatcgcggcgaaatcacaagccgtggcagagcaagtaattattcaatacggcggt
tctgtaaatgatgcaaatgccgctgaattatttactcagccagacatcgatggcgcatta
gtgggtggtgcatcattaaaagcccctgcatttgcagtaattgttaaagcagcagctgca
gcgaaaaactaa

DBGET integrated database retrieval system