KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_08100Help
Entry
HICON_08100       CDS       T01400                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:hil01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hil01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hil00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hil00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hil00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(597883..598674)
Genome map
AA seq 263 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELIEGLKAELHDVTGCDVAIAPPVMYLGTAEAALSGCGC
SCGGKSVIQLGAQNVDINVKGAFTGDISSEMLKDFGAKYIIIGHSERRTYHKESDEFVAK
KFGALKEAGLVPVLCIGESEAENEAGKTEEVCARQIDAVINALGVEAFNGAVIAYEPIWA
IGTGKSATPAQAQAVHAFIRGHIAAKSQAVAEQVIIQYGGSVNDANAAELFTQPDIDGAL
VGGASLKAPAFAVIVKAAAAAKN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtcctttagttatgggtaactggaaattaaacggtagcaaagcattcacg
aaagaattaatcgagggattaaaagcggaattacatgatgtaacaggttgtgatgtagca
attgccccccccgttatgtatttaggtacggctgaagcagcactttctggttgtggttgc
agctgtggcggtaaaagtgtgattcaattaggtgcacaaaacgtagatatcaatgtgaaa
ggtgcatttactggtgatatttctagcgaaatgttaaaagatttcggtgcaaaatatatc
attattggccactctgaacgccgcacttatcataaagaaagcgacgaatttgtggcgaaa
aaatttggtgcattaaaagaagctggtttagtgccagtattatgtattggtgaatctgaa
gcagaaaacgaagcaggcaaaactgaagaagtgtgcgcgcgtcaaattgatgcggtgatc
aatgcgttaggtgtagaagcattcaacggtgcagtgatcgcatacgaaccaatctgggca
attggcacgggtaaatctgcaactccagcacaagcgcaagcagttcacgcatttatccgt
ggtcacatcgcggcgaaatcacaagccgtggcagagcaagtaattattcaatacggcggt
tctgtaaatgatgcaaatgccgctgaattatttactcagccagacatcgatggcgcatta
gtgggtggtgcatcattaaaagcccctgcatttgcagtaattgttaaagcagcagctgca
gcgaaaaactaa

DBGET integrated database retrieval system