KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_08600Help
Entry
HICON_08600       CDS       T01400                                 

Definition
DNA-binding transcriptional regulator CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:hil00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
649356..650165
Genome map
AA seq 269 aa AA seqDB search
MLTLKEHLLNQVLLIAYQAGKHLQQFYQKQVHVELKEDNTPVTEADLFVSQFLTEKLTAL
FPNVHVLSEENCHISFEERKNWKEYWLIDPLDGTQQFINRTDQFSVLITLVRKNKPVLSI
IHAPILSTTYYAMRDFGAFKKQLDQVKKLTKNTTNFDRPLRIAVGATTSQEKVRSILPKD
FPCEFVVVGSSSLKSGLVAEGAVDCYVRLGQTGEWDTAGAEVLLGETHGAIFDSHFEPLT
YNQRETLINPHFVMVGDQSFDWRSVFQFN
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctgacgttaaaagaacatttacttaaccaagtattgctgattgcttaccaagcgggt
aagcatttgcaacagttttatcaaaaacaggttcatgttgaattgaaagaagacaacacg
cctgtgacggaagcggatctttttgtgagtcaatttttaacagaaaaattgaccgcactt
ttccctaatgtccacgttctttcggaagaaaattgccatatttcctttgaagaacgtaaa
aattggaaagaatattggttgattgatcctcttgatggcacacagcaatttattaatcgt
accgatcaattttctgtgttgataaccttagttcgtaaaaataaacccgtgttaagcatt
attcatgcgccaattttatcgacaacttattatgcaatgcgtgatttcggagcgtttaaa
aaacaactggatcaggtaaaaaaactcactaaaaacacgacaaattttgaccgcccttta
cgaattgcggtaggtgcaaccacttcacaagaaaaagtgcggtcgattttgccgaaggat
tttccttgtgaatttgttgtggttggttcaagtagcttaaaaagcggtttagtggctgaa
ggtgcggtagattgttatgttcgtttaggacaaacaggcgaatgggataccgctggcgct
gaagtgctactaggtgaaactcacggtgccatttttgactctcattttgagcctttaacc
tataaccaacgcgaaacattgattaatccgcattttgttatggtgggcgatcaatcgttc
gattggcgttctgtctttcaatttaattga

DBGET integrated database retrieval system