KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_09120Help
Entry
HICON_09120       CDS       T01400                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HICON_09120
Enzymes [BR:hil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HICON_09120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(705109..706029)
Genome map
AA seq 306 aa AA seqDB search
MRKTLTVLGSINADHVISVPYFAKPGETLTGQNYQIAYGGKGANQAVAAARLGAKVAFIS
CIGSDSIGKTMKNAFEQEGIDTTHINTVSQEMTGMAFIQVAKSSENSIVLASGANAHLGE
MVVRQSEAQIAQSDCLLMQLETPLSGVELAAQIAKKNGVKVVLNPAPAQILSDELLSLID
IITPNETEAEILTGVAVTDEQSAVKAASVFHDQGIKTVMITLGAKGVFVSRKGKSRIIKG
FCVQAIDTTAAGDTFNGGFVTALLEEKSFDEAIRFGQAAAAISVTKKGAQSSIPMRQETL
EFLEHA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaccctcacggttctcggtagtatcaatgctgatcacgttatttctgtgcct
tactttgctaaacccggtgaaacgctaacaggtcaaaattatcaaattgcctatggtggc
aaaggtgccaatcaagcagtggcagccgctcgtttaggggcaaaggtcgcgttcattagt
tgcattggatcagatagcataggcaaaacaatgaaaaatgcgtttgagcaagaaggaatt
gatacaacccatattaataccgtttcacaggaaatgacgggaatggcatttattcaagtc
gccaagtctagtgagaacagtattgtgttggctagcggtgcaaatgcacatttgggtgag
atggttgttcgtcaaagtgaggcacaaattgcacaatcggattgcttgttaatgcaatta
gaaaccccactttctggtgtggagctggctgctcaaatcgctaagaaaaatggtgttaag
gttgtgctaaatcctgctccagcgcagattttatcggacgaattattgagtttgattgat
attattacaccaaatgaaactgaagctgaaatcctgacgggggtagcggtaaccgacgag
caaagtgcggtgaaagctgcgagtgtttttcacgatcaaggcattaaaaccgtaatgatt
acccttggtgcgaaaggcgtgtttgtcagtcgaaaaggtaaaagccgcatcattaagggc
ttttgtgtgcaagcaatagatactaccgcagctggtgatacatttaatggcggttttgtt
acggctttattggaagaaaaatcctttgatgaagccattcgttttgggcaagctgccgct
gcgattagtgtgacgaaaaaaggggctcaatcctctattccaatgcggcaagaaactttg
gaatttcttgaacacgcttaa

DBGET integrated database retrieval system