KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_10080Help
Entry
HICON_10080       CDS       T01400                                 

Definition
acetyl-CoA carboxylase, carboxytransferase subunit alpha
Orthology
K01962  
acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HICON_10080
   01212 Fatty acid metabolism
    HICON_10080
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HICON_10080
   00640 Propanoate metabolism
    HICON_10080
  Lipid metabolism
   00061 Fatty acid biosynthesis
    HICON_10080
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    HICON_10080
Enzymes [BR:hil01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     HICON_10080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
803690..804637
Genome map
AA seq 315 aa AA seqDB search
MNQEYLDFELPIAELEAKIEALCSASDDKVDLTDEIKRLQKKSNELTKKTFANLDAWQVS
RMARHPNRPYTLDYIEHIFTEFEELAGDRAFADDKAIVGGLARLDGRPVMVIGHQKGRTV
KDKVSRNFGMPAPEGYRKALRLMEMAERFKLPIITFIDTPGAYPGIGAEERGQAEAIARN
LREMAQLTVPVICTVIGEGGSGGALAIGVGDKVNMLQYSTYSVISPEGCASILWKSAEKA
STAAEVMGLTASRLKELNLIDSIVQEPLGGAHRNYLEIAENLKLRLKEDLAELDGLSKEE
LLNRRYERLMSYGYC
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaagaatatttagattttgaattaccgattgccgaattagaagcaaaaattgaa
gcattatgctcagcatcggatgataaagttgatttaactgatgaaatcaaacgcttacaa
aagaaaagtaacgaactcactaaaaaaacctttgctaaccttgatgcttggcaagtttca
cgtatggcacgtcatccaaaccgcccttatacattagattatatcgaacatatttttacg
gaatttgaagaacttgcaggcgatcgtgcttttgctgatgataaagcgattgttggtggc
ttggcgcgtttagatggtcgcccagtgatggtgattggtcatcaaaaaggccgtactgta
aaagataaagtgagtcgtaattttggtatgcctgcacctgaaggctatcgtaaagcgtta
cgtttaatggaaatggctgaacgttttaaattgccaattattacatttattgacacacca
ggggcttatccaggtattggcgcagaagaacgtggtcaagcggaagctattgctcgcaac
ttacgcgaaatggcacaacttaccgttcctgttatttgtaccgttatcggtgaaggcggt
tcaggcggtgcattagctattggcgtgggcgataaagtgaatatgttgcagtattccact
tattctgttatctcgcctgaaggctgtgcttctattctttggaaaagtgcggaaaaagca
tcgactgcagcggaagtaatgggattaaccgcaagccgtttaaaagaattaaatcttatc
gatagcattgtgcaagaacctttaggtggggcgcatcgtaattatctagaaatagctgaa
aacttaaaacttcgtttaaaagaagatttagcagagcttgacggactaagcaaagaagaa
ttattaaatcgacgctatgaacgtttaatgtcttacggttattgctaa

DBGET integrated database retrieval system