KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_11630Help
Entry
HICON_11630       CDS       T01400                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hil00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HICON_11630
Enzymes [BR:hil01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HICON_11630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
937346..937960
Genome map
AA seq 204 aa AA seqDB search
MIGRLQGILLEKQPPEILLNVQGVGYELLLPMTSFYDLPEIGQETTLFTHLVVREDAHLL
FGFAQKTDRTLFRELIKTNGVGPKLALAILSAMSVEQFAYAIEREELSKLTKIPGVGKKT
AERLLVELKGKFKGVKQSDFFVESTHIPLSPSIESHSESSSDEAISALIALGYKPAEAEK
MVKRVVKPELTSEQVIREALKAAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcttacaaggcattcttttagaaaaacaacctccagaaattttactcaat
gtgcaaggcgtaggctatgaattgcttttgccgatgacgagtttctatgatttaccagaa
attggacaagaaacaactttattcacccatcttgttgttcgtgaagatgctcacttactc
tttggatttgcccagaaaacagaccgcactttatttcgtgaattaattaaaacaaatggg
gtggggcctaaattagccttagcgattttatccgccatgtcggtcgaacaatttgcttac
gcaattgagagagaagaactttctaaactcactaaaattccaggtgttggcaaaaaaaca
gctgaacgtttgttagttgaactcaaaggtaaatttaaaggcgtaaaacaaagcgatttc
tttgtagaaagtacgcatattccattatccccatctattgaatcccactcggaaagttca
tctgatgaagcaatttcagccttaattgctttaggttataaacctgcagaagcagaaaaa
atggtaaaacgcgttgttaaacctgaattaaccagtgaacaagttattcgtgaagcatta
aaagccgcattgtag

DBGET integrated database retrieval system