KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_14400Help
Entry
HICON_14400       CDS       T01400                                 

Definition
dihydrolipoyltranssuccinase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HICON_14400
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HICON_14400
  Amino acid metabolism
   00310 Lysine degradation
    HICON_14400
Enzymes [BR:hil01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HICON_14400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1265468..1266697
Genome map
AA seq 409 aa AA seqDB search
MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVVLEVPALSDGVLAEVV
QAEGETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAAIENSHNHNADQSPAIR
RLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEAATEQNTISTVAYSARSE
KRVPMTRLRKRIAERLLEAKNSTAILTTFNEVDMQPIMTLRKTYGEKFEKQHSVRLGFMS
FYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPRGLVTPVLRDCDKLSMAEIE
KQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKERPI
ALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLEI
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcgaaattcttgttccagacctacctgaatcagttgctgatgcaactgttgct
acttggcataaaaaactgggcgatacagtgaaacgtgatgaagttattgtggaaattgaa
acggataaagttgtgctagaagttcccgcactttctgatggtgtactggctgaagttgtt
caagctgagggcgaaacagtggtgagtaaacagttgctaggaaaaatttctacggctcaa
gaaggagatgtcagttcagcgacgttaaaagcaacgaatgaacccacaccatcagatcgt
caaaatgcagcgattgaaaatagtcataatcataatgcggatcagagccctgcaattcgt
cgtttattagcagaacatgatttacaagcagatcaaattcaaggttcgggtgtggggggg
cgtttaacacgtgaagatattgaacgtgaaattgcaaaacgacaagcacagcaagtgaaa
caagaagctgccactgagcaaaatacaattagtacggtggcttatagcgcacgttctgaa
aaacgtgtgccaatgacccgtttgcgtaaacgtattgctgaacgtttacttgaagccaaa
aatagtacggcgattcttaccactttcaatgaagtggatatgcagccgataatgactctg
cgtaaaacctacggcgaaaaatttgaaaaacaacattcagtacgtttaggatttatgtct
ttttatattaaagcggttgtggaagcattaaaacgttatcctgaagtgaatgcttctatt
gatggggatgatgttgtttaccataactattttgatattagtattgcggtttcgactcct
cgtggattagtcacaccagtgcttcgtgattgcgataagctcagtatggcagagatcgaa
aaacaaattaaagcattagctgaaaaaggtcgtgatggcaaattaacagtagaagatctt
actggcggcaattttaccatcacaaatggtggcgtgttcggttctcttatgtccactcca
attatcaatccaccacaaagtgcgattttaggaatgcacgctattaaagaacgcccgatt
gcacttaatggtcaagttgtgattcgtcctatgatgtaccttgctttatcttacgatcat
cgtttaattgacggccgtgaatctgttggtttcttggtaacgattaaagaattattggaa
gatccaacaagattgttattagaaatctaa

DBGET integrated database retrieval system