KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_17070Help
Entry
HICON_17070       CDS       T01400                                 

Definition
(GenBank) tryptophan biosynthesis protein trpCF
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
hil00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hil01100  Metabolic pathways
hil01110  Biosynthesis of secondary metabolites
hil01130  Biosynthesis of antibiotics
hil01230  Biosynthesis of amino acids
Module
hil_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HICON_17070
Enzymes [BR:hil01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HICON_17070
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     HICON_17070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CBY87143
Position
complement(1530905..1532338)
Genome map
AA seq 477 aa AA seqDB search
MMITQDFTKPIDFGTVLQKIVLDKAQWVKAKETEFPLSQFKQNIQKSDRSFYAALAKGTH
QKPAYILECKKASPSKGLIRAEFNLEDIANVYKHYASAVSVLTDEKYFQGNFEFLPLVRD
IVSQPVLCKDFMISEYQVYLARYYQADAILLMLSVVNDETYRVLAELAHSLGMGVLTETS
NEDEFERALALGAKIIGVNNRNLHDLTVDLNRVVELTKKYADCIPADVRIISESGIYNHK
QIHQLQKVAHGFLIGSSLMGNQDLNNAVRSVIFGENKVCGLTRAQDVKIVYENGALYGGL
IFVEHSKRCVSLRQAQELVTAAPLRFVGVFQNQEIDFIVKIANQLQLYAVQLHGAETEAF
ITALRQQLPKNTQIWKAISVNIESQSAVDFTDNLNVERYIFDSQTANQQGGTGKTFDWSL
IPENLKHKIILAGGISPNNVEQAIQQNCLGLDINSGVESSAGVKDQEKVRLVFNNIY
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcactcaagattttactaaacctattgatttcggtacggtgctacaaaaaatt
gtgcttgataaagcgcaatgggttaaagcaaaggaaactgaatttcccctttctcagttt
aaacaaaacattcaaaaatctgaccgctctttttatgcagcattagcaaaaggcacgcat
caaaagcccgcctatattttggaatgtaaaaaagcctctccttctaagggattaattcgt
gctgaatttaatttggaagacatcgccaatgtctataaacattatgcctctgctgtatct
gtgctgacagatgaaaaatacttccaaggcaattttgaatttttgcctttagttcgcgat
atcgtaagccaacctgtgctttgcaaagattttatgattagcgaatatcaagtttacctt
gctcgctactatcaagcggatgcaattttattaatgctttctgtggtaaacgatgagact
tatcgtgtgctggcagagcttgcgcattctcttggtatgggtgtattgacagaaaccagc
aatgaagatgaatttgaacgtgcccttgcgcttggtgcgaaaattattggtgttaataat
cgtaacttgcacgatttaacagtggatttaaatcgtgttgttgaactcactaaaaaatac
gccgactgtattcctgctgatgtacgtattattagcgaatcaggcatttacaatcacaag
caaattcatcaattacaaaaggtggcgcatggtttcttaattgggagtagtttaatgggc
aaccaagatttgaataatgcggttcgctcggtaatttttggagaaaataaagtatgcggt
ttaacgcgcgcgcaagatgtcaaaatcgtttacgaaaacggggcactttacggcggatta
atcttcgtagaacattcaaaacgttgtgtgagtttacgccaagcgcaagaattagtaacc
gctgcgccacttcgatttgttggtgtttttcagaatcaagaaattgactttatcgtcaaa
atagccaaccagttacagctttatgcggtgcaattacatggtgcagaaactgaagcattt
attaccgcacttcgccagcaactaccaaaaaacacgcaaatctggaaagcgatttcagtc
aatatcgaatcccaaagtgcggtcgattttaccgataatttaaatgtagaacgttatatt
tttgatagccaaacagcgaaccaacaaggtggcacggggaaaacttttgattggtcatta
attcctgaaaatcttaaacacaagattattttagctggcggcatttcaccaaataatgtg
gaacaagccattcaacaaaattgcttaggcttggatattaattctggggtggaaagttct
gctggcgtaaaagatcaagaaaaagtgcggttagtttttaataatatttattaa

DBGET integrated database retrieval system