KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_17140Help
Entry
HICON_17140       CDS       T01400                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HICON_17140
   00240 Pyrimidine metabolism
    HICON_17140
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    HICON_17140
   03430 Mismatch repair
    HICON_17140
   03440 Homologous recombination
    HICON_17140
Enzymes [BR:hil01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     HICON_17140
DNA replication proteins [BR:hil03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     HICON_17140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1525018..1525452
Genome map
AA seq 144 aa AA seqDB search
MAKTAQFYILTENCTLTVEEIACNLAASIWRSGKKVLISCESESQALEIDELLWQRDPSE
FVPHNLSGEATQYPTPIEISWLGKRNLQRRDVLINLQQEIPDFSHSFTQLIDFVPKDDAL
RTQARERYKQLRALGWALSTENIA
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaactgcacaattttatattcttacggaaaattgtactttaactgtcgaagaa
atagcctgtaatcttgctgcttcaatatggcgttcagggaaaaaagtactaattagttgc
gaaagtgagagccaagcattagaaattgatgaacttttgtggcaacgagatcccagtgaa
tttgttccgcataatttatcaggtgaggcaacacaatatcccacaccgattgagatttca
tggcttggaaaacgaaatttacaacgccgtgatgtgttaatcaatttgcaacaagaaatc
ccagattttagccatagcttcacccaacttattgattttgtaccgaaagatgatgcttta
agaacacaagctcgagaacgttacaaacagttaagagcattgggatgggcactttctaca
gaaaatatagcataa

DBGET integrated database retrieval system