KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_17240Help
Entry
HICON_17240       CDS       T01400                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HICON_17240
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HICON_17240
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HICON_17240
Enzymes [BR:hil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HICON_17240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1514282..1515478)
Genome map
AA seq 398 aa AA seqDB search
MSDTLLNPYFGEFGGMYVPEILVPVLKQLEQAFVEAQNDPTFQAEFADLLKNYAGRPTAL
TLCHNLTKGTKAKIYLKREDLLHGGAHKTNQVLGQILLAKRMGKTRIIAETGAGQHGVAT
ALACAMLDMPCRIYMGAKDVDRQSPNVFRMRLMGAEVIPVQKGSCSLKDACCEAMRDWSA
NYETTHYLLGTAAGPHPFPTIVREFQKMIGEETKRQILEREGRLPDAVIAAVGGGSNAIG
MFTDLIDEPNVRLIGVEPAGKGIESGEHGAPLGHAKVGIYFGMKSPLMQTEDGQVEESYS
VSAGLDFPSVGPQHAYLNAIGRADYVSITDEEALNAFQELAKHEGIIPALESSHALAYAL
KLIKQNPEKEQLLVVNLSGRGDKDIFTVDKILTEKGMK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacacacttcttaatccttattttggcgaatttggcggaatgtacgtgccagaa
attttagtgcctgttttaaagcaattagaacaagcctttgtggaggctcaaaatgatcct
acattccaagcagaatttgctgatttactcaaaaattatgcgggcagaccgaccgcactt
accctttgtcacaacctaacaaaaggtactaaagcgaaaatctatcttaaacgtgaagat
ttattacacggtggtgcgcacaaaaccaatcaagtgttagggcaaattttactggctaaa
cgtatgggcaaaacacgtattattgccgaaacaggtgcagggcagcatggtgttgcgaca
gcccttgcttgtgctatgttagatatgccatgccgtatttatatgggcgcaaaagatgtt
gatcgtcaatcgccgaatgtatttcgtatgcgtctaatgggcgcagaggtgattcctgta
caaaaaggctcttgctctttaaaagacgcttgttgtgaggctatgcgtgattggtcagca
aactacgaaactacccattatttacttggaaccgctgcaggccctcaccccttcccgacg
attgtgagagaatttcaaaaaatgattggcgaagaaaccaaacgtcaaattctcgaacgg
gaaggtcgtttacctgatgcagtgattgctgcggttggcggtggttctaacgcaattggc
atgtttactgatcttattgatgaaccaaatgttcgtttaattggtgttgaacctgcgggg
aaaggtattgaaagcggtgaacatggtgcaccattaggtcatgcaaaagttggcatttat
ttcgggatgaaatcccctttaatgcaaaccgaagatggtcaagtagaggaatcctactct
gtttcagctgggttagacttcccttctgttgggcctcaacatgcttatttaaatgcgatt
ggtcgtgctgattatgtatcgattaccgatgaagaagcccttaacgcattccaagaattg
gcaaaacacgaaggtattattcctgcattagaaagctcacacgccttggcttatgccttg
aaattgattaaacaaaatcctgaaaaagaacaacttttagtcgttaatctttcaggacga
ggcgataaagatatttttaccgttgataaaattttgacagaaaaaggaatgaaataa

DBGET integrated database retrieval system