KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_17250Help
Entry
HICON_17250       CDS       T01400                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HICON_17250
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HICON_17250
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HICON_17250
Enzymes [BR:hil01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HICON_17250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1513473..1514282)
Genome map
AA seq 269 aa AA seqDB search
MSRFETQFSTLNAKNEGAFVPFATLCDPTFDRSFEIICTLVDNGADALELGFPFSDPLLD
GPVIQAANNRALTAGHSTEDSFKLLEKVRSKYPEIPISLLLCANLIFAKGLDAFYQRCAE
VGVDAVLVADIPLLAKEDYVQAAKKHGIQPVFICPPNADEKTIQGVAKNSEGYTYLVSRA
GVTSAENQAHAANLDTLIEQLKAHNAPPILQGFGIAQPEQVKDALSLGAAGVISGSATVK
IIERNLDNQAKLLEELNDFVRAMKQATQA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttttgaaacgcaattttcgacacttaacgcaaaaaatgaaggggctttcgtg
ccgttcgctaccctttgcgaccctactttcgaccgctcttttgagatcatttgcacactt
gtggataacggtgcagatgctttagaactcggttttcctttttccgatccgctactcgat
ggcccagttattcaagccgcgaataatcgcgctttaactgcgggacatagcactgaagat
agctttaagttattagaaaaagtgcggtcaaaatatccagagattccgattagcttatta
ctttgtgccaatttaatttttgccaaaggtttagatgctttttatcaacgctgtgcagaa
gtcggtgttgatgctgtgcttgtagcagatattccgttactcgcaaaagaagattatgtg
caagcagctaaaaaacacggcattcaacccgtctttatttgcccgccaaatgcggacgag
aaaactattcaaggcgtagcgaaaaatagcgaaggctatacctatttagtctcacgtgct
ggcgtaaccagtgcagaaaatcaagctcacgcagcaaatttagatacccttatagaacag
cttaaagcgcataatgccccgccaattttacaaggcttcggcattgctcaaccagagcaa
gttaaagacgcgttatctttgggggcagccggtgtgatttcaggttcggcaacggtgaaa
attattgagcgaaatttggataatcaggcgaaattgctcgaagaacttaacgattttgtg
agagcaatgaaacaggctactcaggcttaa

DBGET integrated database retrieval system