KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_17710Help
Entry
HICON_17710       CDS       T01400                                 

Definition
exonuclease V (RecBCD complex) subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hil03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1470283..1472205
Genome map
AA seq 640 aa AA seqDB search
MLSVLHKLKEQGILSQGDYYFAKLIADKQCHTGYAEPVKNLAILLAALCSWRYTQGNTCS
QLDRYLEHNLFGLAYRTTEEDYLAEIREKIGYLAVEDWQNALRGHIAFTQDPVNQIAPMA
FQFGALYFYRAWQDEYRIAQYIKNTLKKHRTLAFSYDEIHQKLDKYFPEKQEKTDWQKVA
VATAIKSPFSIITGGPGTGKTTTVTRLLLVLQELFDCKLHIKLVAPTGKAASRLEESIKN
ALGFMQEKMNVSDSLFNAIPQKASTLHSLLGVNAFNDYTRYNSHNPLQLDVLVVDETSMI
DLPMMAKLINALKPETRLILLGDQAQLASVEAGAVLGELAQFVTQPYSHEQATYLQATTG
YKVEGSDCSNPIRDCLCHLTESRRFDKDSGIGKLAEFIQKGKADDSLELFDHYPQELHFN
ALNDESDAVNQVVKSAVENYRTFLKMLDDLRKQKIDPNAKNEQGISYAEAIQVQFNSVRF
LTALRNNNLGVENLNKEIALALREEKLLWFRNEQDWYIGKPIMITENDHNVRLYNGDIGL
CLANGKVWFGNREVLTSRIPAHEPAFMMTIHKSQGSEFKHTVMVLPTEVNPVLSRELVFT
GVTRAKKELTVFADEKIWKTAIRQTVKRQSGLGKLLEDLN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttatctgtattacacaaacttaaagagcagggcattctttctcaaggggattattat
tttgctaagttgatagctgataaacaatgtcatacgggttatgcggaaccagtcaaaaat
ttagccatattattagccgcactgtgtagttggcgttatacgcaaggaaatacttgcagc
caattagatcgctatttagaacataatttatttggtttggcttatcgtacaacggaagaa
gattatttagcagaaattcgtgaaaagattggttatttagctgtggaagattggcaaaat
gcgttgcgcgggcatattgcatttacgcaagatcctgtcaatcaaattgcgccaatggca
tttcaatttggcgcgttgtatttctatcgagcttggcaagatgaatatcgcatcgcacaa
tatataaaaaacaccttaaaaaaacaccgcactttagccttttcttatgatgaaattcat
caaaaattagataaatatttccctgaaaaacaggaaaaaacagattggcaaaaagtggca
gtggcgacagcgattaaaagtccattttcgattattacaggcggcccaggaacaggaaaa
accaccacagttacgcgtttattgctcgttctacaagaattatttgattgtaaattacac
atcaaattggttgcgccgactggcaaagccgcctcccgtttggaagagtcgattaaaaat
gcgttaggttttatgcaagaaaaaatgaatgtatccgattcacttttcaatgcgattcca
caaaaagccagcaccttgcatagtttactgggcgtgaacgcctttaatgattacacgcgc
tataacagccataaccctttgcaattagatgtgttagttgtcgatgaaacatcaatgatt
gatttgccgatgatggcaaaacttatcaatgcgttaaagcccgaaacccgattaatttta
ttaggcgatcaagcgcaattagcctctgttgaggcgggggcagtattgggagaattagct
caatttgttactcaaccttatagtcatgaacaagccacgtatttacaagcgacaacaggt
tacaaagtagaaggttccgattgttcaaatccaatacgtgattgcttatgccatctaaca
gaaagtcgccgttttgataaagattcaggcattggcaagttggctgaattcattcaaaaa
ggcaaagcagacgatagccttgagttatttgaccattatccgcaagaattgcactttaat
gccctaaatgatgaaagcgatgcggtcaatcaagtggtgaaaagtgcggtggaaaattac
cgcactttcttaaaaatgttggatgatttacgtaaacaaaaaattgatcctaacgctaaa
aatgaacaaggcatttcctatgccgaagctattcaagtgcaatttaattctgtgagattt
ttaaccgcacttcgtaataacaatttaggtgtcgaaaatctcaataaagaaattgcgtta
gcgttgcgagaggaaaaattgctttggttccgtaatgaacaagattggtatatcggcaag
ccaattatgattactgaaaacgatcataatgttcgcctttataacggcgatattggactg
tgcttggcaaatggcaaagtatggtttggcaatcgagaagtgctgacaagccgaattcca
gcgcatgagcccgcttttatgatgacgattcataaatctcaaggttcagaatttaaacat
accgtcatggtgcttccaacagaagtaaatccagtactgtcgcgagaattagttttcacg
ggcgtcactcgtgcgaaaaaagaactcactgtatttgccgatgaaaaaatatggaaaaca
gcgattcgccagaccgtcaaacgccagagcggattgggaaaattattggaagatttaaat
tag

DBGET integrated database retrieval system