KEGG   Haemophilus influenzae F3047 (nontypeable): HICON_17760Help
Entry
HICON_17760       CDS       T01400                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
hil  Haemophilus influenzae F3047 (nontypeable)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hil00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HICON_17760
Enzymes [BR:hil01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     HICON_17760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1464220..1464825
Genome map
AA seq 201 aa AA seqDB search
MKTTLLKTLTPELNLVQHNDIPVLHLKHAVGTAKISLQGAQLISWKPQTAKQDVLWLSEV
EPFKNGNAIRGGVPICYPWFGGVKQPAHGTARIRLWQLSHYDISAHKVRLEFELFSDLNI
IEAKVSMVFTDKCHLTFTHYGEESAQAALHTYFNIGDINQVEVQGLPETCFNSLNQQQEN
VPSPRHIYENVDCIYSAETMP
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaacattactaaaaacactgacaccagagcttaatcttgttcaacataacgac
attccagttcttcacttaaaacatgcggttggaacagcaaaaatttccttgcaaggggca
cagcttatcagttggaaaccgcaaactgcgaagcaagatgtattatggttaagtgaagta
gaaccattcaaaaatggcaatgccattcgtgggggagtgccgatttgttatccttggttt
ggtggcgtaaaacaacctgcacacggcacagctcgtattcgtttatggcagttaagccat
tatgatatttcagcccataaagtgcggttagaatttgagttgttttctgatttaaatatt
atcgaagctaaagtctcaatggtatttacagataaatgtcatttaacttttacccattat
ggcgaagaatcagcccaagcagcattacatacctattttaatattggggatattaatcaa
gtggaagtacaaggtttacctgaaacttgttttaatagcttaaaccaacaacaagaaaat
gttccgtcaccgcgtcacatttatgaaaatgttgattgcatttattccgcagaaacaatg
ccataa

DBGET integrated database retrieval system