KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0064Help
Entry
HI0064            CDS       T00001                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HI0064 (folK)
Enzymes [BR:hin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HI0064 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
67873..68355
Genome map
AA seq 160 aa AA seqDB search
MITAYIALGSNLNTPVEQLHAALKAISQLSNTHLVTTSSFYKSKPLGPQDQPDYVNAVAK
IETELSPLKLLDELQRIENEQGRVRLRRWGERTLDLDILLYGNEIIQNERLTIPHYDMHN
REFVIVPLFEIASDLVLPNSQIITELVKQFADHKMIKLNP
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattacggcatatattgctctaggtagcaatttaaacacaccagtagaacaattacat
gctgcgcttaaagcgataagtcagttatcaaacactcatttggtaacaacgagctctttt
tataaaagcaaaccgctcggcccacaagatcaacccgattatgtgaatgccgttgcaaaa
attgaaaccgaacttagtccgctcaagctattagatgaattacagcgtattgaaaacgag
caaggtcgagtgcgtttacgtcgctggggcgaacgcacgttagatttagatattttgctc
tacggcaatgaaattattcaaaacgaacgcttaacaattccccattatgatatgcataac
cgtgagtttgtcattgtgccgttgtttgaaatcgcatcggatttagttttaccaaatagt
caaatcataacagagctggtcaagcaatttgctgaccacaaaatgataaaattaaatccc
tag

DBGET integrated database retrieval system