KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0102Help
Entry
HI0102            CDS       T00001                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HI0102 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    HI0102 (dapE)
Enzymes [BR:hin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HI0102 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(108685..109818)
Genome map
AA seq 377 aa AA seqDB search
MKEKVVSLAQDLIRRPSISPNDEGCQQIIAERLEKLGFQIEWMPFNDTLNLWAKHGTSEP
VIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGSLAAMIVAAEEYVKANP
NHKGTIALLITSDEEATAKDGTIHVVETLMARDEKITYCMVGEPSSAKNLGDVVKNGRRG
SITGNLYIQGIQGHVAYPHLAENPIHKAALFLQELTTYQWDKGNEFFPPTSLQIANIHAG
TGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNLKYRIEWNLSGKPFLTKPGK
LLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVEFGPLNSTIHKVNECVSVEDL
GKCGEIYHKMLVNLLDS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaagtggtttcgttggcacaagatttaattcgtcgcccgtctattagccca
aatgacgaaggctgtcagcaaattattgccgaacgtttagaaaaattaggttttcaaatt
gaatggatgccttttaatgacacgttgaatttgtgggcaaaacacggaacgagcgagcca
gttattgcttttgcaggtcatacggatgttgtgcctactggcgatgaaaatcaatggtcg
tctccgccgttttctgcggagattattgatggcatgctttatgggcgtggtgcggcggat
atgaaaggctcccttgcagcaatgattgtggcggcagaagaatacgtaaaagcaaatcct
aatcataaaggcaccattgcattattgattacctctgatgaagaggctaccgcaaaagat
ggaactatacacgtggttgagacgttaatggcgcgtgatgaaaaaattacttattgtatg
gttggcgagccatcgagtgctaaaaacttaggagatgttgtcaaaaatggtcgccgcggc
tcaattacaggaaatctctatattcaaggtattcaaggacacgtagcctatccgcattta
gctgaaaacccaatccataaagcagcgctatttttgcaagaattaacgacttaccaatgg
gataaaggcaatgaatttttcccgccaacaagcctacaaattgctaacattcacgcgggt
acgggaagtaataatgtaattcctgctgagttatatattcagttcaatttgcgttattgc
acagaagtcacggatgaaatcattaagcaaaaagtggctgaaatgctagaaaaacacaat
ttgaaatatcgtattgaatggaatttatcaggcaaaccctttttaacaaaaccaggtaaa
ttattagattcgataacctccgctattgaggaaaccataggcataacgccaaaggctgaa
acaggtggcggcacgtcagacggtcgttttattgcattgatgggcgcagaagtagtggaa
tttggcccgttaaattcaaccattcataaagtcaatgaatgtgtcagtgtagaagacctt
ggcaagtgcggtgaaatttaccacaaaatgttagtgaatttattggatagctaa

DBGET integrated database retrieval system