KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0286Help
Entry
HI0286            CDS       T00001                                 

Definition
(RefSeq) aminotransferase AlaT (EC:2.6.1.2)
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    HI0286
   01230 Biosynthesis of amino acids
    HI0286
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HI0286
   00290 Valine, leucine and isoleucine biosynthesis
    HI0286
   00220 Arginine biosynthesis
    HI0286
Enzymes [BR:hin01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     HI0286
    2.6.1.66  valine---pyruvate transaminase
     HI0286
Amino acid related enzymes [BR:hin01007]
 Aminotransferase (transaminase)
  Class I
   HI0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
319804..321018
Genome map
AA seq 404 aa AA seqDB search
MRLFPKSDKLEHVCYDIRGPVHKEALRLEEEGNKILKLNIGNPAPFGFEAPDEILVDVLR
NLPSAQGYCDSKGLYSARKAIVQYYQSKGILGATVNDVYIGNGVSELITMAMQALLNDGD
EVLVPMPDYPLWTAAVTLSGGKAVHYLCDEDANWFPTIDDIKAKVNAKTKAIVIINPNNP
TGAVYSKELLQEIVEIARQNNLIIFADEIYDKILYDGAVHHHIAALAPDLLTVTLNGLSK
AYRVAGFRQGWMILNGPKHNAKGYIEGLDMLASMRLCANVPMQHAIQTALGGYQSINEFI
LPGGRLLEQRNKAYDLITQIPGITCVKPMGAMYMFPKIDVKKFNIHSDEKMVLDLLRQEK
VLLVHGKGFNWHSPDHFRIVTLPYVNQLEEAITKLARFLSDYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcgattattcccaaaatccgacaaattagaacacgtatgttatgacattcgcggacct
gtgcataaagaagcactacgcttagaagaagaaggcaataaaattttaaaacttaatatc
ggcaatcccgcacctttcggctttgaagcaccagatgaaattttggtggacgtattgcgt
aatttgccgtcagctcaaggctactgcgattcaaaaggattatattctgctcgtaaagcc
attgttcaatattaccaatcaaaagggattctcggcgcgaccgtcaatgatgtgtatatt
ggtaacggcgtatctgagcttatcacaatggcaatgcaagcattgctcaatgatggcgat
gaagtgcttgtgccgatgcctgattatccgctttggactgctgcggtaaccctttctggc
ggtaaagcagtgcattatctctgtgatgaagacgcaaattggtttcccactattgatgat
attaaagcaaaggtgaatgcgaaaactaaagcgattgtcatcatcaacccgaacaaccca
acgggtgctgtgtatagcaaagaattattacaagaaattgtggaaatcgcgcgtcaaaat
aatttaattatcttcgctgacgaaatctacgacaaaattttatatgatggcgcggtgcat
catcacattgccgcacttgctcctgatttattaaccgttacattgaatgggttatcaaaa
gcttatcgagttgcaggcttccgccaaggctggatgattttgaacggcccaaaacataat
gcgaaaggttatattgaaggcttggatatgctggcatcaatgcgtttatgtgccaacgta
ccaatgcaacatgcaattcaaaccgcacttggtggctatcaaagtattaatgaatttatt
ttaccaggcggtcgattacttgagcaacgaaacaaagcctatgatctcatcactcaaatt
ccaggcattacttgcgtgaaaccaatgggggcgatgtatatgttcccgaaaattgatgtg
aaaaaattcaatattcacagtgatgaaaaaatggtgctggatttactccgccaagaaaaa
gtactacttgtgcacggtaaaggatttaattggcattcaccagatcacttccgtattgtt
actcttccttatgtgaatcagcttgaagaagccattacaaaattagcaagatttttgtcg
gattaccgtcaataa

DBGET integrated database retrieval system