KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0313Help
Entry
HI0313            CDS       T00001                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hin00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HI0313 (ruvA)
Enzymes [BR:hin01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HI0313 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(345069..345683)
Genome map
AA seq 204 aa AA seqDB search
MIGRLQGILLEKQPPEILLNVQGVGYELLLPMTSFYDLPEIGQETTLFTHLVVREDAHLL
FGFAQKTDRTLFRELIKTNGVGPKLALAILSAMSVEQFAYAIEREELSKLTKIPGVGKKT
AERLLVELKGKFKGVKQSDFFVESTHIPLSPSIESHSESSSDEAISALIALGYKPVEAEK
MVKRVAKPELTSEQVIREALKVAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcttacaaggcattcttttagaaaaacaacctccagaaattttactcaat
gtgcaaggcgtaggctatgaattgcttttgccgatgacgagtttctatgatttaccagaa
attggacaagaaacaactttattcacccatcttgttgttcgggaagatgctcacttactc
tttggatttgcccagaaaacagaccgcactttatttcgtgaattaattaaaacaaatggg
gtggggcctaaattagccttagcgattttatccgccatgtcggtcgaacaatttgcctat
gcaatagagagagaagaactttctaaacttactaaaattccaggtgttggcaaaaaaaca
gctgaacgtttgttagttgagctcaaaggtaaatttaaaggcgtaaaacaaagcgatttc
tttgtagaaagtacgcatattccattatccccatctattgaatcccactcggaaagttca
tctgatgaagcaatttcagccttgattgctttaggttataaacctgtagaagcagaaaaa
atggtaaaacgcgttgctaaacctgaattaaccagtgaacaagttattcgtgaagcatta
aaagtcgcattgtag

DBGET integrated database retrieval system