KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0313Help
Entry
HI0313            CDS       T00001                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hin03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(345069..345683)
Genome map
AA seq 204 aa AA seqDB search
MIGRLQGILLEKQPPEILLNVQGVGYELLLPMTSFYDLPEIGQETTLFTHLVVREDAHLL
FGFAQKTDRTLFRELIKTNGVGPKLALAILSAMSVEQFAYAIEREELSKLTKIPGVGKKT
AERLLVELKGKFKGVKQSDFFVESTHIPLSPSIESHSESSSDEAISALIALGYKPVEAEK
MVKRVAKPELTSEQVIREALKVAL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgcttacaaggcattcttttagaaaaacaacctccagaaattttactcaat
gtgcaaggcgtaggctatgaattgcttttgccgatgacgagtttctatgatttaccagaa
attggacaagaaacaactttattcacccatcttgttgttcgggaagatgctcacttactc
tttggatttgcccagaaaacagaccgcactttatttcgtgaattaattaaaacaaatggg
gtggggcctaaattagccttagcgattttatccgccatgtcggtcgaacaatttgcctat
gcaatagagagagaagaactttctaaacttactaaaattccaggtgttggcaaaaaaaca
gctgaacgtttgttagttgagctcaaaggtaaatttaaaggcgtaaaacaaagcgatttc
tttgtagaaagtacgcatattccattatccccatctattgaatcccactcggaaagttca
tctgatgaagcaatttcagccttgattgctttaggttataaacctgtagaagcagaaaaa
atggtaaaacgcgttgctaaacctgaattaaccagtgaacaagttattcgtgaagcatta
aaagtcgcattgtag

DBGET integrated database retrieval system