KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0429Help
Entry
HI0429            CDS       T00001                                 

Gene name
glmS
Definition
glucosamine--fructose-6-phosphate aminotransferase (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:hin00520]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:hin00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(451754..453586)
Genome map
AA seq 610 aa AA seqDB search
MCGIVGAVAQRDVAEILINGLHRLEYRGYDSAGVAVINKQNELQRIRCLGKVKALDEAVS
EKPLIGGTGIAHTRWATHGEPSETNAHPHSSGTFAVVHNGIIENHEELRELLKSRGYVFL
SQTDTEVIAHLVEWEMRTTDSLLDAVKKAVKQLTGAYGMVVMDSRHPEHLVAARSGSPLV
IGLGIGENFLASDQLALLSVTRRFIFLEEGDIAEITRRTVDIYDTHGNKAKREIHESNLE
NDAAEKGKFRHFMQKEIYEQPTALINTMEGRINHENVIVDSIGNGAKGILEKVEHIQIVA
CGTSYNAGMVARYWFESLAGVSCDVEIASEFRYRKFVTRPNSLLITLSQSGETADTLAAL
RLAKEKGYMAALTICNVAGSSLVRESDLAFMTRAGVEVGVASTKAFTTQLAALLMLVTAL
GKVKGHISVEKEREIIKAMQSLPAEIEKALAFDTEIEALAEDFAEKHHALFLGRGAFYPI
AVEASLKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKVKSNIEEVRA
RGGQLYVFADKEAGFTPSEGMKIITMPKVNDIVAPIFYTIPMQLLSYYVALIKGTDVDQP
RNLAKSVTVE
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattgtcggcgcagtagcacaacgagatgtagcggaaatcttaattaatggt
ttacatcgtttagaatatcgtggttatgattcagctggtgttgcagtaatcaataaacaa
aatgaattacaacgtattcgttgtttaggcaaagttaaagctttagatgaagccgtatca
gaaaaaccattaattggtggaacgggaattgcacatacccgctgggcaactcacggcgaa
ccatcagaaactaatgcgcatccgcattcatcaggtacttttgctgtagtacataacggt
attattgaaaatcacgaagaacttcgcgaattattaaaatctcgtggttatgtcttttta
tcacaaaccgatactgaagtgatcgcgcatttagttgaatgggaaatgcgtacgacggat
tcacttttagacgctgtgaaaaaagcagtaaaacaactcactggtgcatacggtatggtg
gtaatggacagccgtcatcctgaacatttagtggcagctcgttctggtagtccacttgtg
attggcttaggtatcggtgaaaatttcttagcttcagatcaacttgcgcttttaagtgtt
acccgccgttttatctttttagaagaaggagatattgcagaaattacacgtcgtacagtt
gatatttatgatactcacggtaataaggctaaacgtgaaattcacgagtctaatcttgaa
aatgacgcggcagagaaaggcaaattccgtcattttatgcagaaagaaatttacgaacag
ccaaccgcacttattaatacaatggaagggcgtatcaatcacgaaaatgtgattgttgat
tcaatcggtaatggtgcaaaaggcattttagaaaaagttgagcatattcaaattgttgct
tgtggtacatcttataatgcaggtatggtggcgcgttattggtttgaatctttagctgga
gtgagctgtgatgttgaaattgcatcagaatttcgttatcgcaaatttgttacccgtcca
aatagcttattgattaccctttctcaatctggcgaaacagccgatactttagctgcactt
cgtttagcgaaagaaaagggctatatggcggcattaacaatttgtaatgttgctggctct
tcgctcgtacgcgaatcagatcttgcatttatgacgcgtgccggtgttgaagttggggta
gcatcaacaaaagcatttacgacacagctcgctgcgttattaatgttggtgacggcactt
ggtaaagttaaaggtcatatttctgtagaaaaagaacgtgaaattattaaagcaatgcaa
tctttacctgctgaaattgaaaaagcgttagcttttgatacagaaattgaagctttagca
gaggattttgctgaaaaacatcatgcacttttcttaggtcgtggtgcgttttatccaatt
gccgtagaggcctctttgaaattgaaagagatttcttatattcacgctgaggcctatgcg
gcgggagaattgaaacacgggccattagcgttaattgatgctgatatgccagtgattgtc
gttgcaccaaataatgaattattagaaaaagtaaaatcgaacattgaggaagtgcgagct
cgtggcggtcaattatacgtatttgccgataaagaagcaggatttacgccaagtgaagga
atgaaaatcatcacgatgccaaaagtcaatgatattgttgcaccgattttttataccatt
ccaatgcaattactttcttattatgtggctttaattaaaggtactgatgtagatcaacct
cgtaacttagcaaaatcagttaccgttgaataa

DBGET integrated database retrieval system