KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0429Help
Entry
HI0429            CDS       T00001                                 

Gene name
glmS
Definition
glucosamine--fructose-6-phosphate aminotransferase (EC:2.6.1.16)
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HI0429 (glmS)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HI0429 (glmS)
Enzymes [BR:hin01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     HI0429 (glmS)
Peptidases [BR:hin01002]
 Cysteine Peptidases
  Family C44
   HI0429 (glmS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(451754..453586)
Genome map
AA seq 610 aa AA seqDB search
MCGIVGAVAQRDVAEILINGLHRLEYRGYDSAGVAVINKQNELQRIRCLGKVKALDEAVS
EKPLIGGTGIAHTRWATHGEPSETNAHPHSSGTFAVVHNGIIENHEELRELLKSRGYVFL
SQTDTEVIAHLVEWEMRTTDSLLDAVKKAVKQLTGAYGMVVMDSRHPEHLVAARSGSPLV
IGLGIGENFLASDQLALLSVTRRFIFLEEGDIAEITRRTVDIYDTHGNKAKREIHESNLE
NDAAEKGKFRHFMQKEIYEQPTALINTMEGRINHENVIVDSIGNGAKGILEKVEHIQIVA
CGTSYNAGMVARYWFESLAGVSCDVEIASEFRYRKFVTRPNSLLITLSQSGETADTLAAL
RLAKEKGYMAALTICNVAGSSLVRESDLAFMTRAGVEVGVASTKAFTTQLAALLMLVTAL
GKVKGHISVEKEREIIKAMQSLPAEIEKALAFDTEIEALAEDFAEKHHALFLGRGAFYPI
AVEASLKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKVKSNIEEVRA
RGGQLYVFADKEAGFTPSEGMKIITMPKVNDIVAPIFYTIPMQLLSYYVALIKGTDVDQP
RNLAKSVTVE
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattgtcggcgcagtagcacaacgagatgtagcggaaatcttaattaatggt
ttacatcgtttagaatatcgtggttatgattcagctggtgttgcagtaatcaataaacaa
aatgaattacaacgtattcgttgtttaggcaaagttaaagctttagatgaagccgtatca
gaaaaaccattaattggtggaacgggaattgcacatacccgctgggcaactcacggcgaa
ccatcagaaactaatgcgcatccgcattcatcaggtacttttgctgtagtacataacggt
attattgaaaatcacgaagaacttcgcgaattattaaaatctcgtggttatgtcttttta
tcacaaaccgatactgaagtgatcgcgcatttagttgaatgggaaatgcgtacgacggat
tcacttttagacgctgtgaaaaaagcagtaaaacaactcactggtgcatacggtatggtg
gtaatggacagccgtcatcctgaacatttagtggcagctcgttctggtagtccacttgtg
attggcttaggtatcggtgaaaatttcttagcttcagatcaacttgcgcttttaagtgtt
acccgccgttttatctttttagaagaaggagatattgcagaaattacacgtcgtacagtt
gatatttatgatactcacggtaataaggctaaacgtgaaattcacgagtctaatcttgaa
aatgacgcggcagagaaaggcaaattccgtcattttatgcagaaagaaatttacgaacag
ccaaccgcacttattaatacaatggaagggcgtatcaatcacgaaaatgtgattgttgat
tcaatcggtaatggtgcaaaaggcattttagaaaaagttgagcatattcaaattgttgct
tgtggtacatcttataatgcaggtatggtggcgcgttattggtttgaatctttagctgga
gtgagctgtgatgttgaaattgcatcagaatttcgttatcgcaaatttgttacccgtcca
aatagcttattgattaccctttctcaatctggcgaaacagccgatactttagctgcactt
cgtttagcgaaagaaaagggctatatggcggcattaacaatttgtaatgttgctggctct
tcgctcgtacgcgaatcagatcttgcatttatgacgcgtgccggtgttgaagttggggta
gcatcaacaaaagcatttacgacacagctcgctgcgttattaatgttggtgacggcactt
ggtaaagttaaaggtcatatttctgtagaaaaagaacgtgaaattattaaagcaatgcaa
tctttacctgctgaaattgaaaaagcgttagcttttgatacagaaattgaagctttagca
gaggattttgctgaaaaacatcatgcacttttcttaggtcgtggtgcgttttatccaatt
gccgtagaggcctctttgaaattgaaagagatttcttatattcacgctgaggcctatgcg
gcgggagaattgaaacacgggccattagcgttaattgatgctgatatgccagtgattgtc
gttgcaccaaataatgaattattagaaaaagtaaaatcgaacattgaggaagtgcgagct
cgtggcggtcaattatacgtatttgccgataaagaagcaggatttacgccaagtgaagga
atgaaaatcatcacgatgccaaaagtcaatgatattgttgcaccgattttttataccatt
ccaatgcaattactttcttattatgtggctttaattaaaggtactgatgtagatcaacct
cgtaacttagcaaaatcagttaccgttgaataa

DBGET integrated database retrieval system