KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0429Help
Entry
HI0429            CDS       T00001                                 

Gene name
glmS
Definition
(RefSeq) glucosamine--fructose-6-phosphate aminotransferase (EC:2.6.1.16)
  KO
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Insulin resistance
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HI0429 (glmS)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HI0429 (glmS)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    HI0429 (glmS)
Enzymes [BR:hin01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     HI0429 (glmS)
Peptidases [BR:hin01002]
 Cysteine Peptidases
  Family C44
   HI0429 (glmS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(451754..453586)
Genome map
AA seq 610 aa AA seqDB search
MCGIVGAVAQRDVAEILINGLHRLEYRGYDSAGVAVINKQNELQRIRCLGKVKALDEAVS
EKPLIGGTGIAHTRWATHGEPSETNAHPHSSGTFAVVHNGIIENHEELRELLKSRGYVFL
SQTDTEVIAHLVEWEMRTTDSLLDAVKKAVKQLTGAYGMVVMDSRHPEHLVAARSGSPLV
IGLGIGENFLASDQLALLSVTRRFIFLEEGDIAEITRRTVDIYDTHGNKAKREIHESNLE
NDAAEKGKFRHFMQKEIYEQPTALINTMEGRINHENVIVDSIGNGAKGILEKVEHIQIVA
CGTSYNAGMVARYWFESLAGVSCDVEIASEFRYRKFVTRPNSLLITLSQSGETADTLAAL
RLAKEKGYMAALTICNVAGSSLVRESDLAFMTRAGVEVGVASTKAFTTQLAALLMLVTAL
GKVKGHISVEKEREIIKAMQSLPAEIEKALAFDTEIEALAEDFAEKHHALFLGRGAFYPI
AVEASLKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKVKSNIEEVRA
RGGQLYVFADKEAGFTPSEGMKIITMPKVNDIVAPIFYTIPMQLLSYYVALIKGTDVDQP
RNLAKSVTVE
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattgtcggcgcagtagcacaacgagatgtagcggaaatcttaattaatggt
ttacatcgtttagaatatcgtggttatgattcagctggtgttgcagtaatcaataaacaa
aatgaattacaacgtattcgttgtttaggcaaagttaaagctttagatgaagccgtatca
gaaaaaccattaattggtggaacgggaattgcacatacccgctgggcaactcacggcgaa
ccatcagaaactaatgcgcatccgcattcatcaggtacttttgctgtagtacataacggt
attattgaaaatcacgaagaacttcgcgaattattaaaatctcgtggttatgtcttttta
tcacaaaccgatactgaagtgatcgcgcatttagttgaatgggaaatgcgtacgacggat
tcacttttagacgctgtgaaaaaagcagtaaaacaactcactggtgcatacggtatggtg
gtaatggacagccgtcatcctgaacatttagtggcagctcgttctggtagtccacttgtg
attggcttaggtatcggtgaaaatttcttagcttcagatcaacttgcgcttttaagtgtt
acccgccgttttatctttttagaagaaggagatattgcagaaattacacgtcgtacagtt
gatatttatgatactcacggtaataaggctaaacgtgaaattcacgagtctaatcttgaa
aatgacgcggcagagaaaggcaaattccgtcattttatgcagaaagaaatttacgaacag
ccaaccgcacttattaatacaatggaagggcgtatcaatcacgaaaatgtgattgttgat
tcaatcggtaatggtgcaaaaggcattttagaaaaagttgagcatattcaaattgttgct
tgtggtacatcttataatgcaggtatggtggcgcgttattggtttgaatctttagctgga
gtgagctgtgatgttgaaattgcatcagaatttcgttatcgcaaatttgttacccgtcca
aatagcttattgattaccctttctcaatctggcgaaacagccgatactttagctgcactt
cgtttagcgaaagaaaagggctatatggcggcattaacaatttgtaatgttgctggctct
tcgctcgtacgcgaatcagatcttgcatttatgacgcgtgccggtgttgaagttggggta
gcatcaacaaaagcatttacgacacagctcgctgcgttattaatgttggtgacggcactt
ggtaaagttaaaggtcatatttctgtagaaaaagaacgtgaaattattaaagcaatgcaa
tctttacctgctgaaattgaaaaagcgttagcttttgatacagaaattgaagctttagca
gaggattttgctgaaaaacatcatgcacttttcttaggtcgtggtgcgttttatccaatt
gccgtagaggcctctttgaaattgaaagagatttcttatattcacgctgaggcctatgcg
gcgggagaattgaaacacgggccattagcgttaattgatgctgatatgccagtgattgtc
gttgcaccaaataatgaattattagaaaaagtaaaatcgaacattgaggaagtgcgagct
cgtggcggtcaattatacgtatttgccgataaagaagcaggatttacgccaagtgaagga
atgaaaatcatcacgatgccaaaagtcaatgatattgttgcaccgattttttataccatt
ccaatgcaattactttcttattatgtggctttaattaaaggtactgatgtagatcaacct
cgtaacttagcaaaatcagttaccgttgaataa

DBGET integrated database retrieval system