KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0443Help
Entry
HI0443            CDS       T00001                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hin03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
464716..465318
Genome map
AA seq 200 aa AA seqDB search
MQSSPLLEHLIENLRCLPGVGPKSAQRMAYHLLQRNRSGGMNLARALTEAMSKIGHCSQC
RDFTEEDTCNICNNPRRQNSGLLCVVEMPADIQAIEQTGQFSGRYFVLMGHLSPLDGIGP
REIGLDLLQKRLVEESFHEVILATNPTVEGDATANYIAEMCRQHNIKVSRIAHGIPVGGE
LETVDGTTLTHSFLGRRQID
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcagtccacttttagaacaccttattgaaaacttacgttgtcttccaggcgta
gggcctaaatctgcgcaacgtatggcttatcatcttttacagcgtaatcgtagcggtgga
atgaatttagctcgagcactcacagaagccatgtctaaaattggtcattgttcacagtgt
cgagactttacggaagaagacacttgcaacatttgcaataatccacgccgtcaaaattca
ggtttgctttgtgtcgttgaaatgccagcagatattcaagcgattgagcaaacggggcaa
ttttcaggacgttattttgttttaatgggacatttgtctccacttgatggtattggacct
cgtgaaattggcttagatttactgcaaaaacgcttagtagaagaatctttccacgaagtg
attcttgcaacaaatccaacggtggaaggcgatgcgacggcaaactacattgctgaaatg
tgccgccaacataatatcaaagtgagtcgtatcgctcacggtatccctgtcggtggtgaa
ctggaaactgtggacggcacaacgcttactcactcttttcttggtcgtcgtcaaatcgac
taa

DBGET integrated database retrieval system