KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0469Help
Entry
HI0469            CDS       T00001                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00340  Histidine metabolism
hin01100  Metabolic pathways
hin01110  Biosynthesis of secondary metabolites
hin01230  Biosynthesis of amino acids
Module
hin_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    HI0469 (hisD)
Enzymes [BR:hin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     HI0469 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 949557
NCBI-ProteinID: NP_438630
UniProt: P44001
Position
491635..492918
Genome map
AA seq 427 aa AA seqDB search
MQTIIWNHLSETEKRKVIMRPVQQNGKNIQQAVNAIRENVAYNGDRALFELCEKFDGVKL
DKLIVSADEIQAASSRISVKLRNAIEQAKTNIEAFHKAQQNQEIDLEIQEGVRCQVVTRP
ISCVGLYIPGGSAPLFSTVLMLAIPAKIAGCKKIVLCSPPPISDEILYTAHLCGVETIYA
IGGAQAVFAMAQGTESVAKVDKIFGPGNAFVTEAKRQVAQNSTAIDMPAGPSEVLVIADE
SADPEFVASDLLSQAEHGADSQVILVATCETLAKETALAIERQLALLPRAETVRKALNHS
RIFIAESLEQAVEISNEYAPEHLIVQTKNARKLLPYLDNAGSIFLGAYSPESMGDYASGT
NHVLPTYGYTKTYSSLGLADFSKRMTVQELTPKGFKNLAETVEVMAEAEQLAAHKMAVSV
RLAKLNI
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaattatttggaatcatttatcagaaactgaaaaacgcaaagtcattatgcgt
ccagtccaacaaaatgggaaaaacattcagcaggcagttaatgccattcgtgaaaatgtg
gcatacaatggcgatcgggcattatttgaactctgtgaaaaatttgatggcgtgaagtta
gataaactcattgtttcggcagatgaaattcaagcggcaagtagtcggatttctgtaaaa
cttcgcaatgcgattgagcaagccaaaacgaacattgaagcctttcacaaagcacagcaa
aatcaggaaattgacctagagatccaagaaggcgtgcgttgccaagttgtgactcgtcca
atttcttgtgtagggctttatattccgggtggttcagcaccgttgttttccaccgtattg
atgttagctattcctgctaaaattgcaggttgtaaaaaaatcgtgctttgttcaccgcca
ccgatctcagatgaaattctctacactgctcatctttgcggtgtggaaactatctacgct
ataggtggtgctcaagcagtttttgcgatggctcaaggcacggaaagcgtggcgaaagta
gataaaattttcggacctggaaacgcatttgtgacagaagcaaaacgtcaggtagcacaa
aatagtacggcgattgatatgcctgcgggaccttcagaagtgttagtaattgcagatgaa
tcggcagatcctgaatttgtggcaagcgatttactctctcaagcggaacatggggcagat
agccaagtgattttggtggcgacctgtgaaactctggcaaaagagaccgcacttgcgatt
gaacgccaacttgctctattacctcgtgctgaaaccgttcgaaaagcgttaaaccacagc
cgtatttttatagcagaaagccttgaacaagcggtagaaattagcaatgaatatgcccct
gaacatttaattgtgcaaacaaaaaacgcccgtaaattattaccatatttagataacgca
ggctcaattttcttaggtgcatattcgcctgaaagtatgggcgattatgccagtggcaca
aaccacgttttgcctacttatggttacaccaaaacttattctagtctaggattagctgat
tttagtaagcgaatgacagtacaagaactcacaccaaaaggttttaaaaaccttgctgaa
acggtggaagtgatggcagaagctgagcaattggcagcacataaaatggcagtaagtgta
agattggcgaaactcaatatctaa

DBGET integrated database retrieval system