KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0529Help
Entry
HI0529            CDS       T00001                                 

Gene name
tdk
Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00240  Pyrimidine metabolism
hin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HI0529 (tdk)
Enzymes [BR:hin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HI0529 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_14 UvrD_C SNF2_N DUF2075
Motif
Other DBs
NCBI-GeneID: 949592
NCBI-ProteinID: NP_438687
UniProt: P44309
Position
complement(552193..552744)
Genome map
AA seq 183 aa AA seqDB search
MNAGKSTTLLQSSYNYRERDMNTLVYTAAIDDRFGVGKVTSRIGISQDAFLFRSETNLFD
EINEHLKKEKVHCVLVDEAQFLSKQQVYQLSDVVDKLKIPVLCYGLRTDFQAELFEGSKY
LLAWADQLEELKTICYCGRKANFVLRLNDQGEVIKEGAQIQIGGNDSYLSVCRLHYKEKC
GQI
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctggaaaatcaacgacgttgctacaatcttcctataactatcgtgagcgtgat
atgaacacattagtttatacggctgcgattgatgatcgttttggcgtgggaaaagtcaca
tcgcgtattggcatttcgcaagatgcctttttatttcgctcggaaaccaatttgtttgat
gaaattaatgagcatttaaaaaaagaaaaagtgcattgcgtgttggtggatgaagctcaa
tttcttagcaaacaacaagtttaccagttgagtgatgttgttgataaactcaaaatccct
gtgctttgttatggcttgcgtacagatttccaagcggaactttttgaaggaagtaaatat
ttactggcttgggcggatcaactcgaagaattaaaaacaatttgttattgtggccgcaag
gctaattttgttttgcgtttaaatgatcagggcgaggtcattaaagaaggtgcacaaatt
caaattggaggcaatgattcttatctttctgtttgccgtttacactataaagaaaagtgc
ggtcaaatttaa

DBGET integrated database retrieval system