KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0645Help
Entry
HI0645            CDS       T00001                                 

Gene name
pldB
Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HI0645 (pldB)
Enzymes [BR:hin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HI0645 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(689231..690172)
Genome map
AA seq 313 aa AA seqDB search
MIREPYFHQFALAELLPFFEQFPTQYLSGKRNIKLAYRHLIQPESAVRKLMILVNGRAEN
MLKWSELAYDFYHQGYDVLLFDHRGQGYSQRIIPQKGHLDEFRFYVDDMAKIIEKVTALF
SYSTQHLLAHSMGALIATYYLANYDHHINKAVLSSPFYGILLKHPIRDELIITLMNILGQ
GERYVFGKGAYQQAHLEYNELTFCKTRMKWMNRINRKNPAINLGGPTFRWVHLCLNAIKR
LPKVIPKIEIPILILQAEKEKIVDNKNLEKLTALFPNARCEVILNAKHEVLFEKDNVRRN
VLKSVNHFLNVQS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatcagagaaccttattttcatcaatttgctcttgcagaattattgcctttttttgag
caatttcctacccaatatctttctggtaaacgaaatataaaattagcttatcgtcatttg
attcaacctgaaagtgcggtcagaaaattgatgattttagtaaatggtcgagcagaaaat
atgctgaaatggtcagagctcgcttatgatttttatcatcaaggttacgatgtattgcta
tttgatcatcgcggtcaaggctattcacagcgtattattcctcaaaaagggcatttagat
gaatttcgtttctatgtcgatgatatggcgaaaatcatcgaaaaagtaaccgcacttttc
agctattcaacgcagcatttgcttgctcattcaatgggcgcattgattgcaacctattat
ttggcaaattatgatcatcacattaataaagcggtactttcttcgcctttttacggtatt
cttttaaaacatcccattagagatgaactgattattaccctaatgaatattttaggacaa
ggcgagcgttatgtttttggcaaaggtgcttatcaacaagcccacttggaatacaatgaa
ttaactttctgtaaaaccagaatgaaatggatgaatcgtataaatcgtaaaaatccagca
attaatcttggcgggccaacattccgttgggtacatttgtgtttgaacgcaattaaacgc
ttgccgaaagttattcctaagattgaaattccaatcctaattttacaagccgaaaaagaa
aaaatagtagataacaaaaatcttgaaaaattaaccgcactttttccgaatgctagatgt
gaagtcatattaaatgctaaacatgaggtgttatttgaaaaagataatgttcgaagaaat
gtacttaaaagtgttaatcattttctaaatgtgcaaagttga

DBGET integrated database retrieval system