KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0757Help
Entry
HI0757            CDS       T00001                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HI0757 (gpmA)
   01230 Biosynthesis of amino acids
    HI0757 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HI0757 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    HI0757 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HI0757 (gpmA)
Enzymes [BR:hin01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HI0757 (gpmA)
Exosome [BR:hin04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HI0757 (gpmA)
  Exosomal proteins of melanoma cells
   HI0757 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
821450..822133
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKTAGKKLLDKGYEFDIAFTSVLTRA
IKTCNIVLEESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDPQDPNSAHNDRRYANIPSDVVPNAENLKLTLERALPFWEDQIAPAMLSGKRVLVVA
HGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDDKLNYVEHYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattagtatttatccgtcacggttttagtgaatggaatgcgaaaaacttattcaca
ggctggcgtgatgtgaatttaactgaacgtggtgtggaagaagcaaaaactgcgggtaaa
aaactgttagacaaaggttatgaatttgatatcgcatttacctctgttttaactcgagca
atcaaaacttgtaacatcgtgttagaagaatcccatcaattatggattccgcaagtaaaa
aactggcgtttaaatgaacgtcattatggtgctttacaaggtttagataaaaaagcgact
gcggagcaatacggtgacgaacaagttcatatttggcgtcgttcttacgacatttctcca
ccagatttagatccacaagatccaaattctgcacacaatgaccgtcgctacgcaaatatt
ccatctgatgttgtgccaaacgcagaaaatttaaaattaacattagaacgtgcattacca
ttctgggaagatcaaattgcaccagcaatgctttctggcaaacgtgttttagtggttgct
cacggaaattcacttcgtgcgttggcaaaacatattatcggtatttctgatgctgaaatt
atggattttgaaattccaacaggccaacctttagtattaaaactagatgataaattaaat
tacgtagaacattactatctttaa

DBGET integrated database retrieval system