KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0757Help
Entry
HI0757            CDS       T00001                                 

Gene name
gpmA
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
hin00010  Glycolysis / Gluconeogenesis
hin00260  Glycine, serine and threonine metabolism
hin00680  Methane metabolism
hin01100  Metabolic pathways
hin01110  Biosynthesis of secondary metabolites
hin01120  Microbial metabolism in diverse environments
hin01130  Biosynthesis of antibiotics
hin01200  Carbon metabolism
hin01230  Biosynthesis of amino acids
Module
hin_M00002  Glycolysis, core module involving three-carbon compounds
hin_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HI0757 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    HI0757 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HI0757 (gpmA)
Enzymes [BR:hin01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HI0757 (gpmA)
Membrane trafficking [BR:hin04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HI0757 (gpmA)
Exosome [BR:hin04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HI0757 (gpmA)
  Exosomal proteins of melanoma cells
   HI0757 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 FMO-like
Motif
Other DBs
NCBI-GeneID: 949776
NCBI-ProteinID: NP_438916
UniProt: P44865
Position
821450..822133
Genome map
AA seq 227 aa AA seqDB search
MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKTAGKKLLDKGYEFDIAFTSVLTRA
IKTCNIVLEESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQYGDEQVHIWRRSYDISP
PDLDPQDPNSAHNDRRYANIPSDVVPNAENLKLTLERALPFWEDQIAPAMLSGKRVLVVA
HGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDDKLNYVEHYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggaattagtatttatccgtcacggttttagtgaatggaatgcgaaaaacttattcaca
ggctggcgtgatgtgaatttaactgaacgtggtgtggaagaagcaaaaactgcgggtaaa
aaactgttagacaaaggttatgaatttgatatcgcatttacctctgttttaactcgagca
atcaaaacttgtaacatcgtgttagaagaatcccatcaattatggattccgcaagtaaaa
aactggcgtttaaatgaacgtcattatggtgctttacaaggtttagataaaaaagcgact
gcggagcaatacggtgacgaacaagttcatatttggcgtcgttcttacgacatttctcca
ccagatttagatccacaagatccaaattctgcacacaatgaccgtcgctacgcaaatatt
ccatctgatgttgtgccaaacgcagaaaatttaaaattaacattagaacgtgcattacca
ttctgggaagatcaaattgcaccagcaatgctttctggcaaacgtgttttagtggttgct
cacggaaattcacttcgtgcgttggcaaaacatattatcggtatttctgatgctgaaatt
atggattttgaaattccaacaggccaacctttagtattaaaactagatgataaattaaat
tacgtagaacattactatctttaa

DBGET integrated database retrieval system