KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0812Help
Entry
HI0812            CDS       T00001                                 

Gene name
galU
Definition
glucosephosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HI0812 (galU)
   00052 Galactose metabolism
    HI0812 (galU)
   00500 Starch and sucrose metabolism
    HI0812 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HI0812 (galU)
Enzymes [BR:hin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HI0812 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(862342..863229)
Genome map
AA seq 295 aa AA seqDB search
MKAVIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSICPKNVTIMHVRQGNAKGLGHAVLCGRPLVGN
ESFAVMLPDVLLAEFSADQKKENLAAMIQRFNETGASQIMVTPVPQENVSSYGVADCGGI
ELNGGESAKINSIVEKPSIEDAPSNLAVVGRYVFSAAIWDLLEKTPIGVGDEIQLTDAID
MLIEKETVEAFHMTGETFDCGDKIGYMEAFVEYGIRHEKLGKEFKSFIKNLAKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttattcctgtcgccggtcttggcacacgtatgttgcccgccacgaaggcg
attccgaaggaaatgctcactttggtggataaaccgttaattcaatacgtggtaaatgaa
tgtgtagctgctggcataaaagaaattgtgctggtaacacattcatcaaaaaatgctatc
gaaaaccattttgatacatcttttgaattagaaacgatgctggaaaaacgtgtgaagcgt
cagcttctagaagaagttcgttctatctgtccaaaaaatgtaaccattatgcacgttcgt
caaggtaatgcgaaaggtttaggtcacgccgtgttatgcggtcgtcctttagtaggaaat
gaatcttttgccgttatgttaccagatgtattattagctgaatttagtgcagatcagaaa
aaagaaaatcttgctgcaatgattcaacgctttaatgaaactggcgcaagccaaattatg
gtaaccccagttccgcaagaaaatgtgagtagctatggtgttgcagattgtggtggcatt
gagcttaatggcggcgaaagtgcaaaaattaatagtattgttgaaaaaccttctattgaa
gacgcaccatcaaatcttgctgtggttgggcgttatgttttttcagcagcaatttgggat
ttgttagaaaaaacaccaattggtgttggcgatgaaatccaattaaccgatgctattgat
atgctaattgaaaaagaaaccgttgaagcatttcatatgacaggggaaacttttgattgc
ggcgataaaattggttatatggaagctttcgtagaatatggtattcgtcacgaaaaatta
ggtaaagaatttaaatcctttatcaaaaatttggcaaaaacgctataa

DBGET integrated database retrieval system