KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0900Help
Entry
HI0900            CDS       T00001                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hin01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hin00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
956115..957221
Genome map
AA seq 368 aa AA seqDB search
MNKKTIVVKFGTSTLTQGSPKLNSPHMMEIVRQIAQLHNDGFRIVIVTSGAIAAGRHYLN
HPQLPPTIASKQLLAAVGQSQLIQAWEKLFAIYDIHIGQLLLTRADIEDRERFLNARDTL
YALLDNHIIPVINENDAVATAEIKVGDNDNLSALVAILVQAEQLYLLTDQQGLFDSDPRK
NPEAKLIPVVEQITDHIRSIAGGSGTNLGTGGMMTKIIAADVATRSGIETIIAPGNRPNV
IADLAYEQNIGTKFIAHQSDRLESRKQWLFAAPSAGIITIDNGAQNAILEQNKSLLPAGI
INVEGRFSRGEVVKIRTQSGKDIALGMPRYNSDALQLIKGRKSADIENVLGYEYGAVAMH
RDDMIILS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaaacaatcgttgtgaaattcggtacaagcacgctaactcagggttcgcca
aaactgaattcgccacatatgatggaaatcgttcgtcaaattgcacaactgcacaatgat
ggatttcgtatagtgatcgtgacttctggtgcgattgcagcgggtcgccattatttaaat
catcctcaattaccacccactatcgcctcaaagcaactgcttgcagcggttggtcagagc
caattaattcaggcttgggaaaaattatttgctatttatgatatccatatcgggcaactt
ttattaacccgtgcagatattgaagatcgcgaacgttttttaaatgcgcgagatacttta
tacgcacttttagataaccacattattcctgtgattaatgaaaatgatgcggtagcgact
gcggaaattaaagtaggagacaatgacaatttatcggcattagtcgctattcttgtgcaa
gcggaacagctttatttattgactgatcaacaaggtttatttgatagtgatccacgtaaa
aatcctgaagcgaaattaattccagttgtagaacaaatcaccgatcatattcgatcaatt
gcaggaggaagtggtacaaatcttggtactggtggaatgatgaccaaaatcattgctgcc
gatgttgcgactcgctctggaattgaaaccattattgctccaggtaatcgcccaaatgta
attgcagatcttgcttatgaacaaaatattggtacaaaatttattgcacaccaatctgat
cgattagaaagccgcaaacaatggcttttcgccgcaccatcggcaggtattattaccatt
gataacggtgcgcaaaatgccattcttgaacaaaataaatctttattacccgctggtatt
attaacgtggaagggcgtttttcgcgtggtgaagtagtcaaaatacgcactcaatcaggt
aaagacattgcgctgggtatgccacgctataacagcgatgctctacaattaattaagggc
agaaaatcagcagacattgagaatgttttaggctatgaatatggcgcagtggcaatgcat
cgtgatgatatgattattttgtcataa

DBGET integrated database retrieval system