KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0900Help
Entry
HI0900            CDS       T00001                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HI0900 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HI0900 (proB)
Enzymes [BR:hin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     HI0900 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
956115..957221
Genome map
AA seq 368 aa AA seqDB search
MNKKTIVVKFGTSTLTQGSPKLNSPHMMEIVRQIAQLHNDGFRIVIVTSGAIAAGRHYLN
HPQLPPTIASKQLLAAVGQSQLIQAWEKLFAIYDIHIGQLLLTRADIEDRERFLNARDTL
YALLDNHIIPVINENDAVATAEIKVGDNDNLSALVAILVQAEQLYLLTDQQGLFDSDPRK
NPEAKLIPVVEQITDHIRSIAGGSGTNLGTGGMMTKIIAADVATRSGIETIIAPGNRPNV
IADLAYEQNIGTKFIAHQSDRLESRKQWLFAAPSAGIITIDNGAQNAILEQNKSLLPAGI
INVEGRFSRGEVVKIRTQSGKDIALGMPRYNSDALQLIKGRKSADIENVLGYEYGAVAMH
RDDMIILS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaaacaatcgttgtgaaattcggtacaagcacgctaactcagggttcgcca
aaactgaattcgccacatatgatggaaatcgttcgtcaaattgcacaactgcacaatgat
ggatttcgtatagtgatcgtgacttctggtgcgattgcagcgggtcgccattatttaaat
catcctcaattaccacccactatcgcctcaaagcaactgcttgcagcggttggtcagagc
caattaattcaggcttgggaaaaattatttgctatttatgatatccatatcgggcaactt
ttattaacccgtgcagatattgaagatcgcgaacgttttttaaatgcgcgagatacttta
tacgcacttttagataaccacattattcctgtgattaatgaaaatgatgcggtagcgact
gcggaaattaaagtaggagacaatgacaatttatcggcattagtcgctattcttgtgcaa
gcggaacagctttatttattgactgatcaacaaggtttatttgatagtgatccacgtaaa
aatcctgaagcgaaattaattccagttgtagaacaaatcaccgatcatattcgatcaatt
gcaggaggaagtggtacaaatcttggtactggtggaatgatgaccaaaatcattgctgcc
gatgttgcgactcgctctggaattgaaaccattattgctccaggtaatcgcccaaatgta
attgcagatcttgcttatgaacaaaatattggtacaaaatttattgcacaccaatctgat
cgattagaaagccgcaaacaatggcttttcgccgcaccatcggcaggtattattaccatt
gataacggtgcgcaaaatgccattcttgaacaaaataaatctttattacccgctggtatt
attaacgtggaagggcgtttttcgcgtggtgaagtagtcaaaatacgcactcaatcaggt
aaagacattgcgctgggtatgccacgctataacagcgatgctctacaattaattaagggc
agaaaatcagcagacattgagaatgttttaggctatgaatatggcgcagtggcaatgcat
cgtgatgatatgattattttgtcataa

DBGET integrated database retrieval system