KEGG   Haemophilus influenzae Rd KW20 (serotype d): HI0982Help
Entry
HI0982            CDS       T00001                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hin  Haemophilus influenzae Rd KW20 (serotype d)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HI0982 (pfkA)
   01230 Biosynthesis of amino acids
    HI0982 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HI0982 (pfkA)
   00030 Pentose phosphate pathway
    HI0982 (pfkA)
   00051 Fructose and mannose metabolism
    HI0982 (pfkA)
   00052 Galactose metabolism
    HI0982 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HI0982 (pfkA)
Enzymes [BR:hin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HI0982 (pfkA)
Protein phosphatases and associated proteins [BR:hin01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HI0982 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1039212..1040177)
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVFGIYDGYQGLYNNKIKQLNRYSVSD
VINRGGTFLGSARFPEFKDPNIRAKCAEILRSHGIDALVVIGGDGSYMGAKLLTEEHSFP
CVGLPGTIDNDVAGTDYTIGYQTALQTAVDAIDRLRDTSSSHQRISIVEIMGRHCSDLTI
SAGIAGGCEYIVASEIEFNREELIQQIERSIIRGKRHAIIAITELLTDVHSLAKEIEARV
GHETRATVLGHIQRGGSPCAFDRILASRMGAYAVDLLLQGKGGYCVGIQNEQLVHHDIID
AINNMQRVFKADWLKVAKRLE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaattgcagttttaacaagtggtggcgatgcgcctggtatgaatgccgca
attcgtggcgtagtacgttctgcacttgcagaaggcttagaagtatttggtatctatgac
ggttatcaaggtttatacaataataaaatcaaacaattaaatcgctatagcgtatctgat
gtgattaatcgtggcggtacttttttaggttctgcacgttttcctgaatttaaagatcct
aatattcgggcaaaatgtgcggaaattttacgttctcacggcattgatgcacttgtggtt
atcggtggtgacggttcttacatgggggcaaaattattaaccgaagaacacagtttccct
tgtgttggcttacccggtactattgataatgatgttgcaggtactgactataccatcggt
tatcaaaccgcattacaaactgcagtggatgcaatcgaccgtttacgtgatacatcaagc
tcacaccaacgtatttctatcgttgaaattatgggtcgccattgtagtgacttaaccatt
tctgcgggcattgctggcggttgtgaatatatcgtcgcatcagaaattgaatttaatcgt
gaagaattaattcaacaaattgaacgtagcattattcgcggtaaacgccacgctattatt
gctatcactgaacttttaaccgatgttcattctctggcaaaagaaattgaagctcgcgtt
ggacacgaaactcgtgcaactgttttagggcatattcaacgtggtggttctccttgtgct
tttgaccgtattcttgcctcacgtatgggcgcatacgcagtagatttattgctacaaggc
aaaggcggctattgcgtaggtatccaaaatgaacaactcgttcatcacgatattattgat
gccattaataatatgcagcgtgtatttaaggctgattggcttaaagtggcaaaacgtttg
gaataa

DBGET integrated database retrieval system